LXL04_015281 | RubberDandelionOmics

Gene overview

LXL04_015281

Reference: OH-1004 Chr: Chr03 Coordinates: 67472121-67474718 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2598 bp · LXL04_015281|LXL04_015281|OH1004|cDNA

atggCTGCAAACAACCCACCAGAAAGGAGAAACTCAAACACCCAACTACTACAGGAGCTCGAAGCTCTCAGCCAGACACTTAACAACACCAACACTTCGTCAATTCCGGCCACCAAGGGCCGAAGAACAAACTCTCTTGTTCTTTCTCGAACCTCCATTCCTCCCATTTTGTCCACCGGAAAAAACGATCATGCTGATGATGACGATCATGACGATGTTATTAAACTCAATCCGAAACCACGATCAAGGCGCATGTCGTT...

CDS

Download CDS FASTA

2598 bp · LXL04_015281|LXL04_015281|OH1004|CDS

ATGGCTGCAAACAACCCACCAGAAAGGAGAAACTCAAACACCCAACTACTACAGGAGCTCGAAGCTCTCAGCCAGACACTTAACAACACCAACACTTCGTCAATTCCGGCCACCAAGGGCCGAAGAACAAACTCTCTTGTTCTTTCTCGAACCTCCATTCCTCCCATTTTGTCCACCGGAAAAAACGATCATGCTGATGATGACGATCATGACGATGTTATTAAACTCAATCCGAAACCACGATCAAGGCGCATGTCGTT...

Protein

Download Protein FASTA

865 aa · LXL04_015281|LXL04_015281|OH1004|PROTEIN

MAANNPPERRNSNTQLLQELEALSQTLNNTNTSSIPATKGRRTNSLVLSRTSIPPILSTGKNDHADDDDHDDVIKLNPKPRSRRMSLSPWRSRPSEETSQKDPPIVTKNLFQDSKPDKQDSSSSEKKTGLWNWKPIRALSHIGKQKISCLLSVEVVTVQGLPPSMNGLRLSVSVRKKETKDGAVQTMPSRVSQGAADFEETLFLKCHVYCVPAGSGNPKAKFEPRPFVIHAFAVDAEELDFGRHTVDLSQLIQESVEKNF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015281`
TK1151 ID	TkA02G348900
OH-1004 ID	LXL04_015281
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	93.500
Protein coverage (%)	TK1151 100.000 / OH-1004 55.491 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015281

Location Chr03:67472121-67474718 (+)

Description Similar to PMI1: Protein PLASTID MOVEMENT IMPAIRED 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g42550`	Necessary for chloroplast and nuclear photorelocation movements via the regulation of chloroplast-actin (cp-actin) filaments in mesophyll cells, and together with PMIR1, in pavement cells.	A plant-specific protein essential for blue-light-induced chloroplast movements.2005 · DOI: 10.1104/pp.105.061887
`At5g20610`	Together with PMI1, necessary for chloroplast and nuclear photorelocation movements via the regulation of chloroplast-actin (cp- actin) filaments in pavement cells.	PLASTID MOVEMENT IMPAIRED1 and PLASTID MOVEMENT IMPAIRED1-RELATED1 Mediate Photorelocation Movements of Both Chloroplasts and Nuclei.2015 · DOI: 10.1104/pp.15.00214
`At5g26160`	Seems not necessary for chloroplast and nuclear photorelocation movements.	PLASTID MOVEMENT IMPAIRED1 and PLASTID MOVEMENT IMPAIRED1-RELATED1 Mediate Photorelocation Movements of Both Chloroplasts and Nuclei.2015 · DOI: 10.1104/pp.15.00214

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015281 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009637 response to blue light Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009902 chloroplast relocation Biological Process

GO:0009903 chloroplast avoidance movement Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0030048 actin filament-based movement Biological Process

GO:0031022 nuclear migration along microfilament Biological Process

GO:1902265 abscisic acid homeostasis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G42550

ath:AT5G20610

ath:AT5G26160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.455

Rank 1 · LXL04_015281 · OH-1004

Nucleus0.311

Rank 2 · LXL04_015281 · OH-1004

Cytoplasm0.311

Rank 3 · LXL04_015281 · OH-1004

Endoplasmic reticulum0.089

Rank 4 · LXL04_015281 · OH-1004

Plastid0.061

Rank 5 · LXL04_015281 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10358.16NT-C2143-289 aa

PF21745.3PMI1_PMIR1-2_C556-703 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015281	`PF10358.16`	NT-C2	143	289	1.1e-13	51.8
LXL04_015281	`PF21745.3`	PMI1_PMIR1-2_C	556	703	2e-50	171.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8E6`	Arabidopsis thaliana	Protein PLASTID MOVEMENT IMPAIRED 1	52.517%	Swiss-Prot	strong database homology
`F4K5K6`	Arabidopsis thaliana	Protein PLASTID MOVEMENT IMPAIRED 1-RELATED 1	32.934%	Swiss-Prot	weak database homology
`Q7Y219`	Arabidopsis thaliana	Protein PLASTID MOVEMENT IMPAIRED 1-RELATED 2	36.782%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card