LXL04_015223 | RubberDandelionOmics

Gene overview

LXL04_015223

Reference: OH-1004 Chr: Chr03 Coordinates: 66351935-66353844 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1086 bp · LXL04_015223|LXL04_015223|OH1004|cDNA

ATGGAGGCAGTGGTGATTGATGCTGGTTCTAAGCTTTTGAAAGCAGGTTTTGCTATTCCAGATCAAGCTCCTTCCATGATTATTCCAACTCAAATGAAAATCATGAACGAAGATGGATCCATGCCTGATTCTCCATCAATTCAAGTTAACAATGTTGATCCAGTTGTACGAGGTTTTGTTAAAGATTGGGATGCTATGGAGGATCTTCTGCACCATGTTCTTTACAATGGTCTAGGATGGGAAATCGGTAATGAAGGACA...

CDS

Download CDS FASTA

1086 bp · LXL04_015223|LXL04_015223|OH1004|CDS

ATGGAGGCAGTGGTGATTGATGCTGGTTCTAAGCTTTTGAAAGCAGGTTTTGCTATTCCAGATCAAGCTCCTTCCATGATTATTCCAACTCAAATGAAAATCATGAACGAAGATGGATCCATGCCTGATTCTCCATCAATTCAAGTTAACAATGTTGATCCAGTTGTACGAGGTTTTGTTAAAGATTGGGATGCTATGGAGGATCTTCTGCACCATGTTCTTTACAATGGTCTAGGATGGGAAATCGGTAATGAAGGACA...

Protein

Download Protein FASTA

361 aa · LXL04_015223|LXL04_015223|OH1004|PROTEIN

MEAVVIDAGSKLLKAGFAIPDQAPSMIIPTQMKIMNEDGSMPDSPSIQVNNVDPVVRGFVKDWDAMEDLLHHVLYNGLGWEIGNEGQILFADPLLTPKAVREQLVQLMFETFNISGFYASEQAVLSLYAVGRISGCTVDIGHGKIDIAPVIEGAVQHVASRRLEIGGSDLTNLLAQELAKSNPNIKLETSEVEKLKEQYACCAEDDLAYDNSLQSCQEEQHTLPDGQVITIKRERYTVGEALFQPSILGLEAHGLVEQLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015223`
TK1151 ID	TkA02G354600
OH-1004 ID	LXL04_015223
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015223

Location Chr03:66351935-66353844 (+)

Description Similar to ARP7: Actin-related protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g60830`	Essential protein required during embryogenesis and all plant development stages, probably through a chromatin-mediated regulation of gene expression.	Arabidopsis ARP7 is an essential actin-related protein required for normal embryogenesis, plant architecture, and floral organ abscission.2005 · DOI: 10.1104/pp.105.065326

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0783000`	Essential protein required during embryogenesis and all plant development stages, probably through a chromatin-mediated regulation of gene expression.	No verified direct reference in this release
`UniProt: A2XMK6`	Essential protein required during embryogenesis and all plant development stages, probably through a chromatin-mediated regulation of gene expression.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015223 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0009653 anatomical structure morphogenesis Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010227 floral organ abscission Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0015629 actin cytoskeleton Cellular Component

GO:0005200 structural constituent of cytoskeleton Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G60830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.674

Rank 1 · LXL04_015223 · OH-1004

Nucleus0.527

Rank 2 · LXL04_015223 · OH-1004

Mitochondrion0.060

Rank 3 · LXL04_015223 · OH-1004

Cell membrane0.056

Rank 4 · LXL04_015223 · OH-1004

Endoplasmic reticulum0.045

Rank 5 · LXL04_015223 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00022.27Actin2-361 aa

PF14450.13FtsA136-298 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015223	`PF00022.27`	Actin	2	361	4.2e-72	243.7
LXL04_015223	`PF14450.13`	FtsA	136	298	7.4e-07	30.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L4Y5`	Arabidopsis thaliana	Actin-related protein 7	78.297%	Swiss-Prot	strong database homology
`A3ANB5`	Oryza sativa subsp. japonica	Actin-related protein 7	73.130%	Swiss-Prot	strong database homology
`A2XMK6`	Oryza sativa subsp. indica	Actin-related protein 7	73.130%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card