LXL04_015053 | RubberDandelionOmics

Gene overview

LXL04_015053

Reference: OH-1004 Chr: Chr03 Coordinates: 62711921-62713728 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1074 bp · LXL04_015053|LXL04_015053|OH1004|cDNA

ATGGCCGGAAATCAGGTTGGCGACGGTCTAACGGTGAATATTGCTGGAATGTCAAAGAATCAACTCTACGATATCATGTCCCAGATGAAGACATTGATTGAACAGAACCAGGACCAAGCGAGGCAAATCTTAATTCAAAACCCTTTACTCACTAAAGCTCTCTTTCAGGCACAAATAATGCTCGGAATGCTGCAGCCACCTCAAGAGATACCAAACATCCAACCTGCCGGAGCTCACCACCCTCAGCCAGCAGCACCGCC...

CDS

Download CDS FASTA

1074 bp · LXL04_015053|LXL04_015053|OH1004|CDS

ATGGCCGGAAATCAGGTTGGCGACGGTCTAACGGTGAATATTGCTGGAATGTCAAAGAATCAACTCTACGATATCATGTCCCAGATGAAGACATTGATTGAACAGAACCAGGACCAAGCGAGGCAAATCTTAATTCAAAACCCTTTACTCACTAAAGCTCTCTTTCAGGCACAAATAATGCTCGGAATGCTGCAGCCACCTCAAGAGATACCAAACATCCAACCTGCCGGAGCTCACCACCCTCAGCCAGCAGCACCGCC...

Protein

Download Protein FASTA

357 aa · LXL04_015053|LXL04_015053|OH1004|PROTEIN

MAGNQVGDGLTVNIAGMSKNQLYDIMSQMKTLIEQNQDQARQILIQNPLLTKALFQAQIMLGMLQPPQEIPNIQPAGAHHPQPAAPPVQPPAPPLRDQTTTPTQQNQATMPISTPPPSSIPPSNPSLPPLQPPQHARGPVNVKSQAALPPHYSTQAPPPPMPPASNPTPLQQPSHITNMPHLPLQPPLQPPLPSQPRPPSMPPFPHQNYSHMGPTPGFQHPGPPQIHHSQPMFHSSSRPPTSIGPPFSQGQPLPPNQQLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015053`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015053

Location Chr03:62711921-62713728 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71800`	One of the multiple factors required for polyadenylation and 3'-end cleavage of pre-mRNAs (By similarity).	Defective RNA processing enhances RNA silencing and influences flowering of Arabidopsis.2006 · DOI: 10.1073/pnas.0606536103 Targeted 3' processing of antisense transcripts triggers Arabidopsis FLC chromatin silencing.2010 · DOI: 10.1126/science.1180278

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015053 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016441 post-transcriptional gene silencing Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0031123 RNA 3'-end processing Biological Process

GO:0031124 mRNA 3'-end processing Biological Process

GO:0042868 antisense RNA metabolic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048589 developmental growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005847 mRNA cleavage and polyadenylation specificity factor complex Cellular Component

GO:0009986 cell surface Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003824 catalytic activity Molecular Function

KEGG gene cross-reference

ath:AT1G71800

bpe:BP1879

sgo:SGO_0210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.836

Rank 1 · LXL04_015053 · OH-1004

Cytoplasm0.292

Rank 2 · LXL04_015053 · OH-1004

Endoplasmic reticulum0.035

Rank 3 · LXL04_015053 · OH-1004

Cell membrane0.020

Rank 4 · LXL04_015053 · OH-1004

Golgi apparatus0.018

Rank 5 · LXL04_015053 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14327.12CSTF2_hinge7-66 aa

PF14304.12CSTF_C323-357 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015053	`PF14327.12`	CSTF2_hinge	7	66	3.5e-16	60.1
LXL04_015053	`PF14304.12`	CSTF_C	323	357	2.5e-09	37.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9G6`	Arabidopsis thaliana	Cleavage stimulating factor 64	43.836%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card