LXL04_015014 | RubberDandelionOmics

Gene overview

LXL04_015014

Reference: OH-1004 Chr: Chr03 Coordinates: 61618337-61636039 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5979 bp · LXL04_015014|LXL04_015014|OH1004|cDNA

atgagggaggtagaggaccttaggtatgatggctatacacttaggaagagtcagaagcccctaaaagagaaattagaggcacaaacaaaagattacaaacgagtcaaagatgaactttatgagctaaaaaatgatcagctacccatggccaagtacaacatcaatagattaacagctgaacttgcagcatcaaatgctagatttaagattgctgagtttaattttaaaaaatttgatgtgtcaagtgataaggtagaggt...

CDS

Download CDS FASTA

5979 bp · LXL04_015014|LXL04_015014|OH1004|CDS

ATGAGGGAGGTAGAGGACCTTAGGTATGATGGCTATACACTTAGGAAGAGTCAGAAGCCCCTAAAAGAGAAATTAGAGGCACAAACAAAAGATTACAAACGAGTCAAAGATGAACTTTATGAGCTAAAAAATGATCAGCTACCCATGGCCAAGTACAACATCAATAGATTAACAGCTGAACTTGCAGCATCAAATGCTAGATTTAAGATTGCTGAGTTTAATTTTAAAAAATTTGATGTGTCAAGTGATAAGGTAGAGGT...

Protein

Download Protein FASTA

1992 aa · LXL04_015014|LXL04_015014|OH1004|PROTEIN

MREVEDLRYDGYTLRKSQKPLKEKLEAQTKDYKRVKDELYELKNDQLPMAKYNINRLTAELAASNARFKIAEFNFKKFDVSSDKVEVMIENHMKWQDKQGEGLGYSAVPPPFNDNYTPPLEPIVLRRPPPGSQSSVPVLVKTETPKQVDHVKVNESNASTSCADKVNCATQDTKTVVSVPPNTGGDAALNSKSNTPTVEKNCPNPPAVPVHAHHLKNLSKGDSAKRKPLRSGSNDSDWSANKTRTKILTTRVQTGPRPSP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015014`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015014

Location Chr03:61618337-61636039 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36020`	Chaperone that binds to RNA, single- (ssDNA) and double-stranded (dsDNA) DNA, and unwinds nucleic acid duplex.	Cold shock domain proteins and glycine-rich RNA-binding proteins from Arabidopsis thaliana can promote the cold adaptation process in Escherichia coli.2007 · DOI: 10.1093/nar/gkl1076 Cold shock domain proteins affect seed germination and growth of Arabidopsis thaliana under abiotic stress conditions.2009 · DOI: 10.1093/pcp/pcp037

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015014 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003690 double-stranded DNA binding Molecular Function

GO:0003697 single-stranded DNA binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G36020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.642

Rank 1 · LXL04_015014 · OH-1004

Nucleus0.440

Rank 2 · LXL04_015014 · OH-1004

Mitochondrion0.066

Rank 3 · LXL04_015014 · OH-1004

Cell membrane0.060

Rank 4 · LXL04_015014 · OH-1004

Endoplasmic reticulum0.048

Rank 5 · LXL04_015014 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19259.5Ty3_capsid655-821 aa

PF03732.25PEG10_N-capsid662-740 aa

PF24626.2SH3_Tf2-11116-1166 aa

PF31073.1DUF88031116-1166 aa

PF19259.5Ty3_capsid1408-1574 aa

PF03732.25PEG10_N-capsid1415-1493 aa

PF24626.2SH3_Tf2-11869-1919 aa

PF31073.1DUF88031869-1919 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015014	`PF19259.5`	Ty3_capsid	655	821	8.2e-22	78.3
LXL04_015014	`PF03732.25`	PEG10_N-capsid	662	740	4.7e-18	66.0
LXL04_015014	`PF24626.2`	SH3_Tf2-1	1116	1166	1e-44	151.2
LXL04_015014	`PF31073.1`	DUF8803	1116	1166	9.5e-11	42.1
LXL04_015014	`PF19259.5`	Ty3_capsid	1408	1574	8.2e-22	78.3
LXL04_015014	`PF03732.25`	PEG10_N-capsid	1415	1493	4.7e-18	66.0
LXL04_015014	`PF24626.2`	SH3_Tf2-1	1869	1919	1e-44	151.2
LXL04_015014	`PF31073.1`	DUF8803	1869	1919	9.5e-11	42.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65639`	Arabidopsis thaliana	Cold shock protein 1	43.103%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card