LXL04_014893 | RubberDandelionOmics

Gene overview

LXL04_014893

Reference: OH-1004 Chr: Chr03 Coordinates: 59148087-59148782 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

696 bp · LXL04_014893|LXL04_014893|OH1004|cDNA

ATGGCAGCCGCTGCAGCTTCGTTTGCCTTCTCAAGACTCGTCACCTCCGCCACTAAACCCCACCTCACCTCCGCCTCCACTTCTCTCCTCCCTCCCAAACACCGCTCTCTCAGCTTCTCTTCATCCATCTCCCCCCTCCGCATCAAAAACCTCCGCCTCACCCGCCATAACCCCATCAAATACTCCACAACTCCCAAAATCACCGCCACCATCTCCGTCGGAGACAAACTCCCCGACGCTACCTTATCCTACTTCGACTC...

CDS

Download CDS FASTA

696 bp · LXL04_014893|LXL04_014893|OH1004|CDS

ATGGCAGCCGCTGCAGCTTCGTTTGCCTTCTCAAGACTCGTCACCTCCGCCACTAAACCCCACCTCACCTCCGCCTCCACTTCTCTCCTCCCTCCCAAACACCGCTCTCTCAGCTTCTCTTCATCCATCTCCCCCCTCCGCATCAAAAACCTCCGCCTCACCCGCCATAACCCCATCAAATACTCCACAACTCCCAAAATCACCGCCACCATCTCCGTCGGAGACAAACTCCCCGACGCTACCTTATCCTACTTCGACTC...

Protein

Download Protein FASTA

231 aa · LXL04_014893|LXL04_014893|OH1004|PROTEIN

MAAAAASFAFSRLVTSATKPHLTSASTSLLPPKHRSLSFSSSISPLRIKNLRLTRHNPIKYSTTPKITATISVGDKLPDATLSYFDSDGELQTTTISDLTKSKKAILFAVPGAFTPTCSQKHLPGFVEKSSELKSKGVDTIACISVNDAFVMKAWKADLKIGDEVLLLSDGNGDFTKAIGCELDLSDKPIGLGVRSRRFAMLVEDGVVKVLNLEEGGAFTSSGAEDMLKAL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014893`
TK1151 ID	TkA02G386110
OH-1004 ID	LXL04_014893
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014893

Location Chr03:59148087-59148782 (+)

Description Similar to PRXIIE: Peroxiredoxin-2E, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52960`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release
`At1g65980`	Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system.	No verified direct reference in this release
`At1g60740`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0192700`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release
`Os06g0625500`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014893 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0034599 cellular response to oxidative stress Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT1G60740

ath:AT1G65980

ath:AT3G52960

dosa:Os02g0192700

dosa:Os06g0625500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.973

Rank 1 · LXL04_014893 · OH-1004

Mitochondrion0.060

Rank 2 · LXL04_014893 · OH-1004

Cytoplasm0.022

Rank 3 · LXL04_014893 · OH-1004

Nucleus0.014

Rank 4 · LXL04_014893 · OH-1004

Peroxisome0.010

Rank 5 · LXL04_014893 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08534.17Redoxin73-227 aa

PF00578.28AhpC-TSA73-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014893	`PF08534.17`	Redoxin	73	227	2.3e-35	122.3
LXL04_014893	`PF00578.28`	AhpC-TSA	73	208	3.9e-14	53.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949U7`	Arabidopsis thaliana	Peroxiredoxin-2E, chloroplastic	61.925%	Swiss-Prot	strong database homology
`Q9XEX2`	Arabidopsis thaliana	Peroxiredoxin-2B	58.896%	Swiss-Prot	strong database homology
`O22711`	Arabidopsis thaliana	Peroxiredoxin-2D	55.828%	Swiss-Prot	strong database homology
`Q7F8S5`	Oryza sativa subsp. japonica	Peroxiredoxin-2E-2, chloroplastic	74.251%	Swiss-Prot	strong database homology
`Q69TY4`	Oryza sativa subsp. japonica	Peroxiredoxin-2E-1, chloroplastic	76.875%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card