LXL04_014837 | RubberDandelionOmics

Gene overview

LXL04_014837

Reference: OH-1004 Chr: Chr03 Coordinates: 57794224-57796708 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

993 bp · LXL04_014837|LXL04_014837|OH1004|cDNA

ATGGATTCCACACCACTGATGTTGAATGACAATGGTGGGGTCTCTGAGAAGATCATCATCGATACCGATCCAGGCATTGATGACAGCATGGCACTTATGATGGCTTTTGAAACACCAAATCTGGAGATCGTTGGATTAACAACCACATTTGGGAATGTTTCCACAAAAGATGCGACTCGCAATGCCTTGCTTCTGTGTGAGATGGCAGGATGTCCAGGTGTTCCTGTTGCCGAAGGTAGTTCTGGACCTCTAAAGGGTGG...

CDS

Download CDS FASTA

993 bp · LXL04_014837|LXL04_014837|OH1004|CDS

ATGGATTCCACACCACTGATGTTGAATGACAATGGTGGGGTCTCTGAGAAGATCATCATCGATACCGATCCAGGCATTGATGACAGCATGGCACTTATGATGGCTTTTGAAACACCAAATCTGGAGATCGTTGGATTAACAACCACATTTGGGAATGTTTCCACAAAAGATGCGACTCGCAATGCCTTGCTTCTGTGTGAGATGGCAGGATGTCCAGGTGTTCCTGTTGCCGAAGGTAGTTCTGGACCTCTAAAGGGTGG...

Protein

Download Protein FASTA

330 aa · LXL04_014837|LXL04_014837|OH1004|PROTEIN

MDSTPLMLNDNGGVSEKIIIDTDPGIDDSMALMMAFETPNLEIVGLTTTFGNVSTKDATRNALLLCEMAGCPGVPVAEGSSGPLKGGEPEIHDFVHGSDGLGNINLPDPKSKKLDKSASEFLVEKVSQYPGEISILALGPLTNLAIAIKRDSSFVTKVKKIVVLGGAFFALGNINPAAEANIYGDPEAADIVFTSGANIVVVGINITTQVKLTDHDLDELRRSTGKHAQFLSDICKFYRDWHVKSDGVYGIFLHDPVSFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014837`
TK1151 ID	TkA02G393290
OH-1004 ID	LXL04_014837
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014837

Location Chr03:57794224-57796708 (-)

Description Similar to URH1: Uridine nucleosidase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36310`	Involved in purine and pyrimidine breakdown rather than in pyrimidine salvage, especially in response to dark stress.	Uridine-ribohydrolase is a key regulator in the uridine degradation pathway of Arabidopsis.2009 · DOI: 10.1105/tpc.108.062612 Arabidopsis nucleoside hydrolases involved in intracellular and extracellular degradation of purines.2011 · DOI: 10.1111/j.1365-313x.2010.04455.x Arabidopsis thaliana nucleosidase mutants provide new insights into nucleoside degradation.2011 · DOI: 10.1111/j.1469-8137.2011.03711.x AMP and GMP Catabolism in Arabidopsis Converge on Xanthosine, Which Is Degraded by a Nucleoside Hydrolase Heterocomplex.2019 · DOI: 10.1105/tpc.18.00899
`At1g05620`	Involved in pyrimidine breakdown, especially in response to dark stress.	Arabidopsis nucleoside hydrolases involved in intracellular and extracellular degradation of purines.2011 · DOI: 10.1111/j.1365-313x.2010.04455.x Arabidopsis thaliana nucleosidase mutants provide new insights into nucleoside degradation.2011 · DOI: 10.1111/j.1469-8137.2011.03711.x AMP and GMP Catabolism in Arabidopsis Converge on Xanthosine, Which Is Degraded by a Nucleoside Hydrolase Heterocomplex.2019 · DOI: 10.1105/tpc.18.00899

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0557900`	Involved in pyrimidine breakdown.	No verified direct reference in this release
`Os09g0567900`	Involved in pyrimidine breakdown.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014837 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006148 inosine catabolic process Biological Process

GO:0006152 purine nucleoside catabolic process Biological Process

GO:0006218 uridine catabolic process Biological Process

GO:0008655 pyrimidine-containing compound salvage Biological Process

GO:0010150 leaf senescence Biological Process

GO:0019358 nicotinate nucleotide salvage Biological Process

GO:0042454 ribonucleoside catabolic process Biological Process

GO:0046135 pyrimidine nucleoside catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008477 purine nucleosidase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05620

ath:AT2G36310

dosa:Os08g0557900

dosa:Os09g0567900

spo:2540168

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.728

Rank 1 · LXL04_014837 · OH-1004

Nucleus0.290

Rank 2 · LXL04_014837 · OH-1004

Mitochondrion0.087

Rank 3 · LXL04_014837 · OH-1004

Peroxisome0.082

Rank 4 · LXL04_014837 · OH-1004

Cell membrane0.056

Rank 5 · LXL04_014837 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01156.25IU_nuc_hydro18-320 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014837	`PF01156.25`	IU_nuc_hydro	18	320	1.3e-91	308.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJM7`	Arabidopsis thaliana	Uridine nucleosidase 1	74.699%	Swiss-Prot	strong database homology
`Q8LAC4`	Arabidopsis thaliana	Probable uridine nucleosidase 2	51.735%	Swiss-Prot	strong database homology
`Q6ZJ05`	Oryza sativa subsp. japonica	Probable uridine nucleosidase 1	74.286%	Swiss-Prot	strong database homology
`Q652Q8`	Oryza sativa subsp. japonica	Probable uridine nucleosidase 2	71.338%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card