LXL04_014796 | RubberDandelionOmics

Gene overview

LXL04_014796

Reference: OH-1004 Chr: Chr03 Coordinates: 57121774-57123476 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1551 bp · LXL04_014796|LXL04_014796|OH1004|cDNA

ATGTCTCCAATAATCAGCGTCCTCGTTGTCACTATGCTCATCTTCTATGCCAGGTTTCTTTACAAGAAATCTTCAAGCAACCCACACCAACTTCCACCTGGTCCAATGTGTTTGCCATTCATCGGATGTACTATCCAAATGCTCCTAAATCAGCCAACTTTTAGGTGGATCCACAACCTCATGGATCAGTTCCACACCCAAATACTTTGTATTCGACTAGGATCTTCAACTCATATCATCACAGTCACTTCCCCAGAGCT...

CDS

Download CDS FASTA

1551 bp · LXL04_014796|LXL04_014796|OH1004|CDS

ATGTCTCCAATAATCAGCGTCCTCGTTGTCACTATGCTCATCTTCTATGCCAGGTTTCTTTACAAGAAATCTTCAAGCAACCCACACCAACTTCCACCTGGTCCAATGTGTTTGCCATTCATCGGATGTACTATCCAAATGCTCCTAAATCAGCCAACTTTTAGGTGGATCCACAACCTCATGGATCAGTTCCACACCCAAATACTTTGTATTCGACTAGGATCTTCAACTCATATCATCACAGTCACTTCCCCAGAGCT...

Protein

Download Protein FASTA

516 aa · LXL04_014796|LXL04_014796|OH1004|PROTEIN

MSPIISVLVVTMLIFYARFLYKKSSSNPHQLPPGPMCLPFIGCTIQMLLNQPTFRWIHNLMDQFHTQILCIRLGSSTHIITVTSPELACEFLKKQEAIFISRPDFFSAYLMSDGYHTTALSPLGDQWRKMRRIITHDMLSSQANKWFQPKRDQEANHLLTYIYNQTEKGSGSGSINIRTVSQHFCGNLVRNMIFGRRFFGKGSEDGGPGEEEIEHIGAIFNILKYLYAFCITDYHPWLRGKTDFDCHEKNMRSALKIARK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014796`
TK1151 ID	TkA02G396810
OH-1004 ID	LXL04_014796
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014796

Location Chr03:57121774-57123476 (+)

Description Similar to CYP79B2: Tryptophan N-monooxygenase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39950`	Converts tryptophan to indole-3-acetaldoxime, a precursor for tryptophan-derived glucosinolates and indole-3-acetic acid (IAA).	Arabidopsis cytochrome P450s that catalyze the first step of tryptophan-dependent indole-3-acetic acid biosynthesis.2000 · DOI: 10.1073/pnas.040569997 Cytochrome P450 CYP79B2 from Arabidopsis catalyzes the conversion of tryptophan to indole-3-acetaldoxime, a precursor of indole glucosinolates and indole-3-acetic acid.2000 · DOI: 10.1074/jbc.m001667200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014796 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006569 L-tryptophan catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009625 response to insect Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009684 indoleacetic acid biosynthetic process Biological Process

GO:0010120 camalexin biosynthetic process Biological Process

GO:0010132 dhurrin biosynthetic process Biological Process

GO:0019756 cyanogenic glycoside biosynthetic process Biological Process

GO:0042742 defense response to bacterium Biological Process

KEGG gene cross-reference

ag:AAT11920

ag:AAT11921

ath:AT4G39950

sbi:8061413

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.907

Rank 1 · LXL04_014796 · OH-1004

Cell membrane0.039

Rank 2 · LXL04_014796 · OH-1004

Plastid0.037

Rank 3 · LXL04_014796 · OH-1004

Cytoplasm0.032

Rank 4 · LXL04_014796 · OH-1004

Mitochondrion0.025

Rank 5 · LXL04_014796 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p45032-496 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014796	`PF00067.28`	p450	32	496	8.1e-76	256.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81346`	Arabidopsis thaliana	Tryptophan N-monooxygenase 1	50.289%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card