LXL04_014788 | RubberDandelionOmics

Gene overview

LXL04_014788

Reference: OH-1004 Chr: Chr03 Coordinates: 56986359-56989749 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2100 bp · LXL04_014788|LXL04_014788|OH1004|cDNA

ATGTCGACAACCGCGGCGTCATCGATCGCAGCTGCTAACACTGCGCTGGTGAAGGACCCCAAGCTTCAATTGAAATCTTTTAATGGATTTAGGAAAAACGCCAGCTACTCGTCCACTTATTCGCTTCTGCTGGACACACGCATACATCCATTTTCATCCATCTCTTCCTCCACCTCGCCTGCCGTCATCAGGGCTGTTTCAACGCCAGCTAAGCAGGAAACTGCTGTTCAAACTAAGAGAAGTAAGGTTGAGATATTCAA...

CDS

Download CDS FASTA

2100 bp · LXL04_014788|LXL04_014788|OH1004|CDS

ATGTCGACAACCGCGGCGTCATCGATCGCAGCTGCTAACACTGCGCTGGTGAAGGACCCCAAGCTTCAATTGAAATCTTTTAATGGATTTAGGAAAAACGCCAGCTACTCGTCCACTTATTCGCTTCTGCTGGACACACGCATACATCCATTTTCATCCATCTCTTCCTCCACCTCGCCTGCCGTCATCAGGGCTGTTTCAACGCCAGCTAAGCAGGAAACTGCTGTTCAAACTAAGAGAAGTAAGGTTGAGATATTCAA...

Protein

Download Protein FASTA

699 aa · LXL04_014788|LXL04_014788|OH1004|PROTEIN

MSTTAASSIAAANTALVKDPKLQLKSFNGFRKNASYSSTYSLLLDTRIHPFSSISSSTSPAVIRAVSTPAKQETAVQTKRSKVEIFKEQSNFIRYPLNEELLTDTPNINEAATQLIKFHGSYQQYDRDERGGRTYSFMLRTKNPCGKVSNQLYLAMDTLADDFGIKTLRLTTRQTFQLHGVVKKDLKTVMSTIIKNMGSTLGACGDLNRNVLAPAAPIVRKDYLFAQETADNIAALLTPQSGFYYDMWVDGEQFMTAEPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014788`
TK1151 ID	TkA02G397180
OH-1004 ID	LXL04_014788
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014788

Location Chr03:56986359-56989749 (-)

Description Similar to SIR1: Sulfite reductase 1 [ferredoxin], chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04590`	Essential protein with sulfite reductase activity required in assimilatory sulfate reduction pathway during both primary and secondary metabolism and thus involved in development and growth.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014788 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000103 sulfate assimilation Biological Process

GO:0006260 DNA replication Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006790 sulfur compound metabolic process Biological Process

GO:0009409 response to cold Biological Process

GO:0019418 sulfide oxidation Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:1900160 plastid chromosome packaging Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009337 sulfite reductase complex (NADPH) Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G04590

nta:107780886

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.938

Rank 1 · LXL04_014788 · OH-1004

Mitochondrion0.092

Rank 2 · LXL04_014788 · OH-1004

Cytoplasm0.028

Rank 3 · LXL04_014788 · OH-1004

Nucleus0.015

Rank 4 · LXL04_014788 · OH-1004

Peroxisome0.015

Rank 5 · LXL04_014788 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03460.23NIR_SIR_ferr134-192 aa

PF01077.28NIR_SIR231-408 aa

PF03460.23NIR_SIR_ferr426-478 aa

PF01077.28NIR_SIR505-642 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014788	`PF03460.23`	NIR_SIR_ferr	134	192	1.3e-28	99.2
LXL04_014788	`PF01077.28`	NIR_SIR	231	408	2.2e-56	190.4
LXL04_014788	`PF03460.23`	NIR_SIR_ferr	426	478	1.3e-28	99.2
LXL04_014788	`PF01077.28`	NIR_SIR	505	642	2.2e-56	190.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ66`	Arabidopsis thaliana	Assimilatory sulfite reductase (ferredoxin), chloroplastic	77.350%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card