LXL04_014761 | RubberDandelionOmics

Gene overview

LXL04_014761

Reference: OH-1004 Chr: Chr03 Coordinates: 56467662-56468921 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1260 bp · LXL04_014761|LXL04_014761|OH1004|cDNA

ATGTCATCATCGTCGGACAATTGCAATTCTCGCCATTTCTCATGGCTGATGAAATCCTGTTTCCCAGACCCACGACCAAACCCCTCCCTCCATTACTCCCCCCCACCGGCGACCGCTTTTTATCACCGACCCACCACCATATCTTCTCTCCCAACCGACCTTCTCCTTGAGTTTCTTTCTCGGGTAGCTCAGTCTTCCCTACCATCTATTTCCCTTGTCTGCCGCCGGTGGTCACAACTAATTGATTCTTCCGAATTCTA...

CDS

Download CDS FASTA

1260 bp · LXL04_014761|LXL04_014761|OH1004|CDS

ATGTCATCATCGTCGGACAATTGCAATTCTCGCCATTTCTCATGGCTGATGAAATCCTGTTTCCCAGACCCACGACCAAACCCCTCCCTCCATTACTCCCCCCCACCGGCGACCGCTTTTTATCACCGACCCACCACCATATCTTCTCTCCCAACCGACCTTCTCCTTGAGTTTCTTTCTCGGGTAGCTCAGTCTTCCCTACCATCTATTTCCCTTGTCTGCCGCCGGTGGTCACAACTAATTGATTCTTCCGAATTCTA...

Protein

Download Protein FASTA

419 aa · LXL04_014761|LXL04_014761|OH1004|PROTEIN

MSSSSDNCNSRHFSWLMKSCFPDPRPNPSLHYSPPPATAFYHRPTTISSLPTDLLLEFLSRVAQSSLPSISLVCRRWSQLIDSSEFYDLRRRRGLLHFAVFVVYYTDSGLFAANYQVSHDSHWGTTSFLNNNYDDAVYPSSYSALSSHARLAAIGRWIYIIGKTTMLRCDAWTGAVTPRSKMSVLRKKFAVAVVAGKVYAAGGSTRTAAVEEYDPKRNAWRVVCHAPKMRYGCIGAAVDGVLYVIGGLKISGTSGNDGTR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014761`
TK1151 ID	TkA02G399160
OH-1004 ID	LXL04_014761
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014761

Location Chr03:56467662-56468921 (-)

Description Similar to At5g26960: F-box/kelch-repeat protein At5g26960

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26960`	F-box/kelch-repeat protein At5g26960.	No verified direct reference in this release
`At4g39590`	F-box/kelch-repeat protein At4g39590.	No verified direct reference in this release
`At1g67480`	F-box/kelch-repeat protein At1g67480.	No verified direct reference in this release
`At1g60570`	Putative F-box/kelch-repeat protein At1g60570.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014761 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0010506 regulation of autophagy Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0071379 cellular response to prostaglandin stimulus Biological Process

GO:0071466 cellular response to xenobiotic stimulus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016234 inclusion body Cellular Component

GO:0031463 Cul3-RING ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT1G60570

ath:AT1G67480

ath:AT4G39590

ath:AT5G26960

dre:100003679

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.746

Rank 1 · LXL04_014761 · OH-1004

Cytoplasm0.205

Rank 2 · LXL04_014761 · OH-1004

Cell membrane0.097

Rank 3 · LXL04_014761 · OH-1004

Endoplasmic reticulum0.056

Rank 4 · LXL04_014761 · OH-1004

Plastid0.023

Rank 5 · LXL04_014761 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646.39F-box47-87 aa

PF12937.13F-box-like47-85 aa

PF25210.2Kelch_FKB95138-246 aa

PF13964.13Beta-prop_Calicin168-415 aa

PF01344.32Kelch_1186-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014761	`PF00646.39`	F-box	47	87	1e-08	35.4
LXL04_014761	`PF12937.13`	F-box-like	47	85	1.3e-06	28.8
LXL04_014761	`PF25210.2`	Kelch_FKB95	138	246	5.7e-10	40.0
LXL04_014761	`PF13964.13`	Beta-prop_Calicin	168	415	1e-05	25.4
LXL04_014761	`PF01344.32`	Kelch_1	186	223	2.2e-12	47.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NPN5`	Arabidopsis thaliana	F-box/kelch-repeat protein At5g26960	58.195%	Swiss-Prot	strong database homology
`Q1PE10`	Arabidopsis thaliana	F-box/kelch-repeat protein At4g39590	26.645%	Swiss-Prot	weak database homology
`Q9CAG8`	Arabidopsis thaliana	F-box/kelch-repeat protein At1g67480	23.871%	Swiss-Prot	weak database homology
`O22698`	Arabidopsis thaliana	Putative F-box/kelch-repeat protein At1g60570	29.018%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card