Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2589 bp · LXL04_014727|LXL04_014727|OH1004|cDNA
ATGGATAAAGCAGTTGCTTCTTCATCACATGACCTTGCCCAACGCCTTTTTGACAAAAATATCGAGTTGGAAAATAAACGCCGTAAGTCAGCTCAAGCAAGAGTACCATCAGATCCAAATGCATGGCAGCAAATGCGTGAAAATTTCGAAACAATAATACTTGAAGACCATACCTTTTCAGAAAAACACAATATTGAATTTTCCCTATGGCAGTTACATTACAGAAGGATTGAGGAATTCAGGGCTCATTACAATGCTGC...
2589 bp · LXL04_014727|LXL04_014727|OH1004|CDS
ATGGATAAAGCAGTTGCTTCTTCATCACATGACCTTGCCCAACGCCTTTTTGACAAAAATATCGAGTTGGAAAATAAACGCCGTAAGTCAGCTCAAGCAAGAGTACCATCAGATCCAAATGCATGGCAGCAAATGCGTGAAAATTTCGAAACAATAATACTTGAAGACCATACCTTTTCAGAAAAACACAATATTGAATTTTCCCTATGGCAGTTACATTACAGAAGGATTGAGGAATTCAGGGCTCATTACAATGCTGC...
Protein
Download Protein FASTA862 aa · LXL04_014727|LXL04_014727|OH1004|PROTEIN
MDKAVASSSHDLAQRLFDKNIELENKRRKSAQARVPSDPNAWQQMRENFETIILEDHTFSEKHNIEFSLWQLHYRRIEEFRAHYNAASATDSSSRAGGAGPARSDRASKIRIQFKTFLSEATGFYHDLILKIRAKYGLPIGQFYPEPENHNMKEKDGKKFTEIKKGLISCHRCLIYLGDLARYKGLYGEGESKSRDYAAASSYYLQAASLWPASGNPHHQLAILATYSGDELMAVYRYFRSLAAENPFSTARDNLIVAFE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014727 |
|---|---|
| TK1151 ID | TkA02G402170 |
| OH-1004 ID | LXL04_014727 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 84.000 |
| Protein coverage (%) | TK1151 51.707 / OH-1004 12.297Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014727 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:55652428-55655397 (+) | |||||||||
| Description | Similar to SMG7: Protein SMG7 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay Biological Process GO:0006952 defense response Biological Process GO:0012501 programmed cell death Biological Process GO:0031347 regulation of defense response Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0090306 meiotic spindle assembly Biological Process GO:0000781 chromosome, telomeric region Cellular Component GO:0000932 P-body Cellular Component GO:0005634 nucleus Cellular Component GO:0005697 telomerase holoenzyme complex Cellular Component GO:0005730 nucleolus Cellular Component GO:0005737 cytoplasm Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G28260 ath:AT5G19400 mmu:226517 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF10374.16EST165-187 aaPF10373.16EST1_DNA_bind200-519 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_014727 | PF10374.16 | EST1 | 65 | 187 | 5.9e-19 | 69.6 |
| LXL04_014727 | PF10373.16 | EST1_DNA_bind | 200 | 519 | 5.2e-59 | 200.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.