LXL04_014680 | RubberDandelionOmics

Gene overview

LXL04_014680

Reference: OH-1004 Chr: Chr03 Coordinates: 54745050-54749546 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1587 bp · LXL04_014680|LXL04_014680|OH1004|cDNA

ATGAAGAGGCGTAATCGTAATACATCTTCAAAATTTCCTCCCACATTGATAGTAATCTATGGcatgttcttctttattcaGTCGCTAACAGCAAGCGCAGCGGGATCTCTCACATCCTGCGATGACACATCTGTACCAGTAATGATCAAAATTTGGGTGAATGGTGTCGAAGGCAAAAAGTTAGAGGGTCAAAGTGCAACATTTAGTGCAAAAATTCCTGAAACAGCCAATGGACTTGCTAAACAGTCTGTTATAATACC...

CDS

Download CDS FASTA

1587 bp · LXL04_014680|LXL04_014680|OH1004|CDS

ATGAAGAGGCGTAATCGTAATACATCTTCAAAATTTCCTCCCACATTGATAGTAATCTATGGCATGTTCTTCTTTATTCAGTCGCTAACAGCAAGCGCAGCGGGATCTCTCACATCCTGCGATGACACATCTGTACCAGTAATGATCAAAATTTGGGTGAATGGTGTCGAAGGCAAAAAGTTAGAGGGTCAAAGTGCAACATTTAGTGCAAAAATTCCTGAAACAGCCAATGGACTTGCTAAACAGTCTGTTATAATACC...

Protein

Download Protein FASTA

528 aa · LXL04_014680|LXL04_014680|OH1004|PROTEIN

MKRRNRNTSSKFPPTLIVIYGMFFFIQSLTASAAGSLTSCDDTSVPVMIKIWVNGVEGKKLEGQSATFSAKIPETANGLAKQSVIIPNPSNCCSNLSSQLPGFTFLAPRGDCDYLVKAKVAQAGGAAGLVVINDSEDIVEMSCSEKTKLDISIPVVMISKLSGDALNKSLSTGGKVEVAIYAPESPLIDPAAAFLWLIAVGTIVLASLWSDITKINDTNEPYNQLSPKVEEENEIIEMNTMSAVAFVITASTFLVLLYLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014680`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014680

Location Chr03:54745050-54749546 (-)

Description Similar to SPPL3: Signal peptide peptidase-like 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43070`	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	No verified direct reference in this release
`At1g05820`	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	No verified direct reference in this release
`At1g63690`	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0433200`	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	No verified direct reference in this release
`Os06g0730900`	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014680 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0033619 membrane protein proteolysis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005765 lysosomal membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0030660 Golgi-associated vesicle membrane Cellular Component

GO:0098553 lumenal side of endoplasmic reticulum membrane Cellular Component

GO:0098554 cytoplasmic side of endoplasmic reticulum membrane Cellular Component

GO:0042500 aspartic endopeptidase activity, intramembrane cleaving Molecular Function

KEGG gene cross-reference

ath:AT1G05820

ath:AT1G63690

ath:AT2G43070

dosa:Os06g0730900

dosa:Os11g0433200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.439

Rank 1 · LXL04_014680 · OH-1004

Cell membrane0.260

Rank 2 · LXL04_014680 · OH-1004

Cytoplasm0.178

Rank 3 · LXL04_014680 · OH-1004

Golgi apparatus0.170

Rank 4 · LXL04_014680 · OH-1004

Endoplasmic reticulum0.134

Rank 5 · LXL04_014680 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02225.28PA99-166 aa

PF04258.19Peptidase_A22B231-513 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014680	`PF02225.28`	PA	99	166	3.6e-11	43.7
LXL04_014680	`PF04258.19`	Peptidase_A22B	231	513	4.7e-100	335.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4V3B8`	Arabidopsis thaliana	Signal peptide peptidase-like 3	57.320%	Swiss-Prot	strong database homology
`Q9MA44`	Arabidopsis thaliana	Signal peptide peptidase-like 5	52.087%	Swiss-Prot	strong database homology
`Q8W469`	Arabidopsis thaliana	Signal peptide peptidase-like 2	45.929%	Swiss-Prot	moderate database homology
`Q53P98`	Oryza sativa subsp. japonica	Signal peptide peptidase-like 2	53.015%	Swiss-Prot	strong database homology
`Q5Z413`	Oryza sativa subsp. japonica	Signal peptide peptidase-like 5	45.062%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card