LXL04_014676 | RubberDandelionOmics

Gene overview

LXL04_014676

Reference: OH-1004 Chr: Chr03 Coordinates: 54688970-54691443 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1222 bp · LXL04_014676|LXL04_014676|OH1004|cDNA

GCTCGGATATCAGGGGTTTACAGCAGCTGAAATAGGGTTTACCATTGAGACCAGAAAACACTCCATAATGAAAGCCTTAACCTCGAAACAGGTTTTGCAGGAGAACGACACCTCTGATACCAGCGCCGTTACATCGCTTACCTTCACCCACAGAGCTCTATCTGATGTTTCGTGCTTGGCTGAGTTCAAGAAGTTGGAGAAATTGGACCTCACCTTCAACAGTCTGTCGTCTCTTGAGGGTCTGAAGCCATGTGTGAACT...

CDS

Download CDS FASTA

1155 bp · LXL04_014676|LXL04_014676|OH1004|CDS

ATGAAAGCCTTAACCTCGAAACAGGTTTTGCAGGAGAACGACACCTCTGATACCAGCGCCGTTACATCGCTTACCTTCACCCACAGAGCTCTATCTGATGTTTCGTGCTTGGCTGAGTTCAAGAAGTTGGAGAAATTGGACCTCACCTTCAACAGTCTGTCGTCTCTTGAGGGTCTGAAGCCATGTGTGAACTTGAAGTGGTTATCAGTTAAACAGAACAAGCTTCGAAGCTTAAAAGGGATTGAAGGGTGTGTTTTTCT...

Protein

Download Protein FASTA

384 aa · LXL04_014676|LXL04_014676|OH1004|PROTEIN

MKALTSKQVLQENDTSDTSAVTSLTFTHRALSDVSCLAEFKKLEKLDLTFNSLSSLEGLKPCVNLKWLSVKQNKLRSLKGIEGCVFLTVLNAGSNMLQSMDEVSNLVRLRALILNDNEIGSICRLDQMKELNTIVLSRNPISKIGESLGKSNSITKLSLSNCKIQDIDSSIKYCTELRELRLTHNEIRALPTELARNTKLQNLDLGNNLIMRWSDLKILSSLTSLKNLNLVGNPVAEKDVLAKKIKNLVPSLQISNARPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014676`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_014676`
Location	Chr03:54688970-54691443 (+)
Description	Similar to roco5: Probable serine/threonine-protein kinase roco5
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014676` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0007059 chromosome segregation Biological Process GO:0007165 signal transduction Biological Process GO:0005634 nucleus Cellular Component GO:0005694 chromosome Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0070062 extracellular exosome Cellular Component GO:0004672 protein kinase activity Molecular Function GO:0004674 protein serine/threonine kinase activity Molecular Function GO:0005085 guanyl-nucleotide exchange factor activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0005525 GTP binding Molecular Function
KEGG gene cross-reference	ddi:DDB_G0294533 hsa:5510 mmu:66385 rno:301618 xtr:448394 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.879

Rank 1 · LXL04_014676 · OH-1004

Cytoplasm0.149

Rank 2 · LXL04_014676 · OH-1004

Cell membrane0.031

Rank 3 · LXL04_014676 · OH-1004

Mitochondrion0.021

Rank 4 · LXL04_014676 · OH-1004

Endoplasmic reticulum0.016

Rank 5 · LXL04_014676 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_1499-237 aa

PF13855.13LRR_8108-164 aa

PF12799.14LRR_4154-190 aa

PF14580.13LRR_9159-283 aa

PF13855.13LRR_8176-234 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014676	`PF23598.2`	LRR_14	99	237	3.2e-06	26.9
LXL04_014676	`PF13855.13`	LRR_8	108	164	2.5e-15	56.7
LXL04_014676	`PF12799.14`	LRR_4	154	190	8.7e-23	80.6
LXL04_014676	`PF14580.13`	LRR_9	159	283	6.2e-10	39.6
LXL04_014676	`PF13855.13`	LRR_8	176	234	2.5e-15	56.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card