LXL04_014653 | RubberDandelionOmics

Gene overview

LXL04_014653

Reference: OH-1004 Chr: Chr03 Coordinates: 54381095-54384788 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2385 bp · LXL04_014653|LXL04_014653|OH1004|cDNA

ATGGTGATGGCTGACAACGAGGGTACCGATAACCCCGATAATCACGAAGATCCTATTAATGATGCTGTTGGTCCTGCTACGCCGCCGCCGCCGCCCAAATCACCATGGAAgacaccaccaccaccacctatGTTAGATGTGCCGGTTGAGGCTCCTCATGCGGATTCCCATTCTTGGCCGGCGCTGTCTTCGCTAAAATCCCCTTCGGCTGCTGTTACAGTGGCTACTAATGCGTCTGCAGTTTCTCCTAAACAAGTCCA...

CDS

Download CDS FASTA

2385 bp · LXL04_014653|LXL04_014653|OH1004|CDS

ATGGTGATGGCTGACAACGAGGGTACCGATAACCCCGATAATCACGAAGATCCTATTAATGATGCTGTTGGTCCTGCTACGCCGCCGCCGCCGCCCAAATCACCATGGAAGACACCACCACCACCACCTATGTTAGATGTGCCGGTTGAGGCTCCTCATGCGGATTCCCATTCTTGGCCGGCGCTGTCTTCGCTAAAATCCCCTTCGGCTGCTGTTACAGTGGCTACTAATGCGTCTGCAGTTTCTCCTAAACAAGTCCA...

Protein

Download Protein FASTA

794 aa · LXL04_014653|LXL04_014653|OH1004|PROTEIN

MVMADNEGTDNPDNHEDPINDAVGPATPPPPPKSPWKTPPPPPMLDVPVEAPHADSHSWPALSSLKSPSAAVTVATNASAVSPKQVQVPTEPQKSHGRGNHNSSSRYSTRQHKPASKPNPNIVPPFQAPLPFHQPPIPPVFTGMAPWPPHIPVCGYAYQPPAGSFSPANGPPRGNLNTYGRPNVQEKGDSFTSGRQNNQPLGSKENIDLQQNSGPRAFIRPPFFGPPAGFIGGPTFPGPPGSIVYLPARPPFSVRVPHPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014653`
TK1151 ID	TkA02G406380
OH-1004 ID	LXL04_014653
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014653

Location Chr03:54381095-54384788 (-)

Description Similar to LARP1A: La-related protein 1A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g21160`	Required for acclimation and survival during thermal stress.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014653 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006402 mRNA catabolic process Biological Process

GO:0006413 translational initiation Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0009749 response to glucose Biological Process

GO:0010286 heat acclimation Biological Process

GO:0010608 post-transcriptional regulation of gene expression Biological Process

GO:0016239 positive regulation of macroautophagy Biological Process

GO:0017148 negative regulation of translation Biological Process

GO:0031929 TOR signaling Biological Process

GO:0038202 TORC1 signaling Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0045070 positive regulation of viral genome replication Biological Process

KEGG gene cross-reference

ath:AT5G21160

hsa:23367

mmu:73158

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.737

Rank 1 · LXL04_014653 · OH-1004

Nucleus0.271

Rank 2 · LXL04_014653 · OH-1004

Cell membrane0.077

Rank 3 · LXL04_014653 · OH-1004

Mitochondrion0.044

Rank 4 · LXL04_014653 · OH-1004

Endoplasmic reticulum0.043

Rank 5 · LXL04_014653 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05383.24La281-336 aa

PF21071.4LARP1_HEAT629-777 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014653	`PF05383.24`	La	281	336	1.8e-23	82.9
LXL04_014653	`PF21071.4`	LARP1_HEAT	629	777	5.1e-62	209.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940X9`	Arabidopsis thaliana	La-related protein 1A	52.090%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card