LXL04_014651 | RubberDandelionOmics

Gene overview

LXL04_014651

Reference: OH-1004 Chr: Chr03 Coordinates: 54372326-54375706 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1950 bp · LXL04_014651|LXL04_014651|OH1004|cDNA

ATGATTTCAGTAGACGAAGCTCTGGGTATAGTGTTGGACGTATCTAAGCGGTTGCCGCCGGTAACGGTGCCCATTCACGATGCTCTTGGCAAGGTCTTGGCTCAGGACATTCGAGCTCCCGATCCTCTTCCCCCATATCCTGCTTCGGTCAAGGATGGATATGCTGTGATTGCTGCCGATGGTCCTGGTGAGTACCCTATCATTACAGAATCAAGAGCAGGGAATGACGGTTTAGGCGTGATTGTAACTCCTGGAACAGT...

CDS

Download CDS FASTA

1950 bp · LXL04_014651|LXL04_014651|OH1004|CDS

ATGATTTCAGTAGACGAAGCTCTGGGTATAGTGTTGGACGTATCTAAGCGGTTGCCGCCGGTAACGGTGCCCATTCACGATGCTCTTGGCAAGGTCTTGGCTCAGGACATTCGAGCTCCCGATCCTCTTCCCCCATATCCTGCTTCGGTCAAGGATGGATATGCTGTGATTGCTGCCGATGGTCCTGGTGAGTACCCTATCATTACAGAATCAAGAGCAGGGAATGACGGTTTAGGCGTGATTGTAACTCCTGGAACAGT...

Protein

Download Protein FASTA

649 aa · LXL04_014651|LXL04_014651|OH1004|PROTEIN

MISVDEALGIVLDVSKRLPPVTVPIHDALGKVLAQDIRAPDPLPPYPASVKDGYAVIAADGPGEYPIITESRAGNDGLGVIVTPGTVAYVTTGGPIPDGADAVVQVEDTQLLESASSEPKRVRILVKTSKGIDIRPVGCDISKDAIVLKAEELLGTAEIGLLATVGVLTVKVYPTPTIGILSTGDELVEPTNESLGRGKIRDSNRAMILAAAVQQKCKVVDLGIARDDEDEIRAVLDKALSPHNNIDILLTSGGVSMGDR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014651`
TK1151 ID	TkA02G406400
OH-1004 ID	LXL04_014651
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014651

Location Chr03:54372326-54375706 (+)

Description Similar to CNX1: Molybdopterin biosynthesis protein CNX1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20990`	Catalyzes two steps in the biosynthesis of the molybdenum cofactor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014651 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006777 Mo-molybdopterin cofactor biosynthetic process Biological Process

GO:0007529 establishment of synaptic specificity at neuromuscular junction Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010038 response to metal ion Biological Process

GO:0032324 molybdopterin cofactor biosynthetic process Biological Process

GO:0045184 establishment of protein localization Biological Process

GO:0072579 glycine receptor clustering Biological Process

GO:0097112 gamma-aminobutyric acid receptor clustering Biological Process

GO:0099645 neurotransmitter receptor localization to postsynaptic specialization membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT5G20990

hsa:10243

mmu:268566

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.469

Rank 1 · LXL04_014651 · OH-1004

Mitochondrion0.278

Rank 2 · LXL04_014651 · OH-1004

Nucleus0.206

Rank 3 · LXL04_014651 · OH-1004

Cell membrane0.102

Rank 4 · LXL04_014651 · OH-1004

Peroxisome0.089

Rank 5 · LXL04_014651 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03453.23MoeA_N2-166 aa

PF00994.30MoCF_biosynth179-324 aa

PF03454.21MoeA_C339-413 aa

PF00994.30MoCF_biosynth452-600 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014651	`PF03453.23`	MoeA_N	2	166	1.1e-38	133.2
LXL04_014651	`PF00994.30`	MoCF_biosynth	179	324	8.2e-61	204.6
LXL04_014651	`PF03454.21`	MoeA_C	339	413	2.1e-09	38.2
LXL04_014651	`PF00994.30`	MoCF_biosynth	452	600	8.2e-61	204.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39054`	Arabidopsis thaliana	Molybdopterin biosynthesis protein CNX1	69.102%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card