LXL04_014594 | RubberDandelionOmics

Gene overview

LXL04_014594

Reference: OH-1004 Chr: Chr03 Coordinates: 53277574-53279105 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1338 bp · LXL04_014594|LXL04_014594|OH1004|cDNA

ATGCATTCCGCTTGTtataatcatcatcatcatcatcatcatcatcttgatCATATTCCAACAATggttcatcatcatcatcaaacTCTTGAACATGAGGAGTTGTTCTCTCGGAGATGCATACTTGTCAATGGCCCAGTTATAGTCGGGGCAGGCCCATCGGGTCTTGCAGTCGGGGCAGGGCTTCATAAACAAGGGGTTCCCTTTGTGATTCTTGATCGTGCCAATTGCATTGCGTCTCTTTGGCAAAACAATACTTA...

CDS

Download CDS FASTA

1338 bp · LXL04_014594|LXL04_014594|OH1004|CDS

ATGCATTCCGCTTGTTATAATCATCATCATCATCATCATCATCATCTTGATCATATTCCAACAATGGTTCATCATCATCATCAAACTCTTGAACATGAGGAGTTGTTCTCTCGGAGATGCATACTTGTCAATGGCCCAGTTATAGTCGGGGCAGGCCCATCGGGTCTTGCAGTCGGGGCAGGGCTTCATAAACAAGGGGTTCCCTTTGTGATTCTTGATCGTGCCAATTGCATTGCGTCTCTTTGGCAAAACAATACTTA...

Protein

Download Protein FASTA

445 aa · LXL04_014594|LXL04_014594|OH1004|PROTEIN

MHSACYNHHHHHHHHLDHIPTMVHHHHQTLEHEELFSRRCILVNGPVIVGAGPSGLAVGAGLHKQGVPFVILDRANCIASLWQNNTYDRLKLHLPKQFCQLPYFPFPKDFPEYPSKYQFINYLESYAKKFEINPRFNESVQLAKYDESCGLWRVRTVSGDCEMEYICRWLVVATGENAEKVVPEFEGLDEFGGAVMHACDYRSGEGFEGKRVLVVGCGNSGMEVSLDLCHHNAFPSMVVRSSVHILPREIAGKSTFELAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014594`
TK1151 ID	TkA02G410130
OH-1004 ID	LXL04_014594
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014594

Location Chr03:53277574-53279105 (-)

Description Similar to YUC3: Probable indole-3-pyruvate monooxygenase YUCCA3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04610`	Involved in auxin biosynthesis.	No verified direct reference in this release
`At4g28720`	Involved in auxin biosynthesis.	No verified direct reference in this release
`At2g33230`	Involved in auxin biosynthesis.	Activation of a flavin monooxygenase gene YUCCA7 enhances drought resistance in Arabidopsis.2012 · DOI: 10.1007/s00425-011-1552-3
`At1g04180`	Involved in auxin biosynthesis.	No verified direct reference in this release
`At5g43890`	Involved in auxin biosynthesis.	Interaction of auxin and ERECTA in elaborating Arabidopsis inflorescence architecture revealed by the activation tagging of a new member of the YUCCA family putative flavin monooxygenases.2005 · DOI: 10.1104/pp.105.063495

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014594 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009635 response to herbicide Biological Process

GO:0009684 indoleacetic acid biosynthetic process Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0010262 somatic embryogenesis Biological Process

GO:0010600 regulation of auxin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0004499 N,N-dimethylaniline monooxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT1G04180

ath:AT1G04610

ath:AT2G33230

ath:AT4G28720

ath:AT5G43890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.366

Rank 1 · LXL04_014594 · OH-1004

Nucleus0.190

Rank 2 · LXL04_014594 · OH-1004

Endoplasmic reticulum0.162

Rank 3 · LXL04_014594 · OH-1004

Mitochondrion0.118

Rank 4 · LXL04_014594 · OH-1004

Cell membrane0.092

Rank 5 · LXL04_014594 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13738.13Pyr_redox_347-242 aa

PF07992.21Pyr_redox_247-233 aa

PF00743.26FMO-like48-362 aa

PF13434.13Lys_Orn_oxgnase112-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014594	`PF13738.13`	Pyr_redox_3	47	242	2.6e-24	86.7
LXL04_014594	`PF07992.21`	Pyr_redox_2	47	233	1.7e-13	51.4
LXL04_014594	`PF00743.26`	FMO-like	48	362	1.5e-26	93.7
LXL04_014594	`PF13434.13`	Lys_Orn_oxgnase	112	232	1e-13	51.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23024`	Arabidopsis thaliana	Probable indole-3-pyruvate monooxygenase YUCCA3	70.460%	Swiss-Prot	strong database homology
`Q9SVU0`	Arabidopsis thaliana	Probable indole-3-pyruvate monooxygenase YUCCA8	68.039%	Swiss-Prot	strong database homology
`O49312`	Arabidopsis thaliana	Probable indole-3-pyruvate monooxygenase YUCCA7	71.739%	Swiss-Prot	strong database homology
`O64489`	Arabidopsis thaliana	Probable indole-3-pyruvate monooxygenase YUCCA9	66.268%	Swiss-Prot	strong database homology
`Q9LKC0`	Arabidopsis thaliana	Probable indole-3-pyruvate monooxygenase YUCCA5	68.395%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card