LXL04_014593 | RubberDandelionOmics

Gene overview

LXL04_014593

Reference: OH-1004 Chr: Chr03 Coordinates: 53232654-53237173 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

846 bp · LXL04_014593|LXL04_014593|OH1004|cDNA

ATGTCATCGCCACATCAACAAACCAAAGTGTTGAACAGACCTCCACTGGCGATAAAGGAGGAGAAATATGCTGCTCGAAGGGCTATTTTGCCAATGCTTCAAGCAGAAGAGGATGAAAGATTTGTGAAAGAATGGAGGAAATATTTAGAAGAAGAGTCGCGGATAATGAAGGATGTGCCAGGGTGGAAAGTTGGGGAGAGTGTTTATAACTCTGGAAGATGGATGCCTCCTGCCACTGGTGAACTTCGCCCTGAGGTCTG...

CDS

Download CDS FASTA

846 bp · LXL04_014593|LXL04_014593|OH1004|CDS

ATGTCATCGCCACATCAACAAACCAAAGTGTTGAACAGACCTCCACTGGCGATAAAGGAGGAGAAATATGCTGCTCGAAGGGCTATTTTGCCAATGCTTCAAGCAGAAGAGGATGAAAGATTTGTGAAAGAATGGAGGAAATATTTAGAAGAAGAGTCGCGGATAATGAAGGATGTGCCAGGGTGGAAAGTTGGGGAGAGTGTTTATAACTCTGGAAGATGGATGCCTCCTGCCACTGGTGAACTTCGCCCTGAGGTCTG...

Protein

Download Protein FASTA

281 aa · LXL04_014593|LXL04_014593|OH1004|PROTEIN

MSSPHQQTKVLNRPPLAIKEEKYAARRAILPMLQAEEDERFVKEWRKYLEEESRIMKDVPGWKVGESVYNSGRWMPPATGELRPEVWRAIRIESDETTPKQTYVQASDLKHPKTTPIRPDDPITPPDRKRGQICEQRTMTEASIRNKPGMASVKDMPLLQDGPPPGGFAPVRYARRIPSKGPSAVAIFLAAFGTFSWGMWQVGKGNKIRRAIKEEKYAARRAILPMLQAEEDERFVKEWRKYLEEESRIMKDVPGWKVGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014593`
TK1151 ID	TkA02G410340
OH-1004 ID	LXL04_014593
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 50.890 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014593

Location Chr03:53232654-53237173 (+)

Description Similar to MEE4: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04630`	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.	No verified direct reference in this release
`At2g33220`	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014593 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009060 aerobic respiration Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009853 photorespiration Biological Process

GO:0022904 respiratory electron transport chain Biological Process

GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process

GO:0035458 cellular response to interferon-beta Biological Process

GO:0042776 proton motive force-driven mitochondrial ATP synthesis Biological Process

GO:0045039 protein insertion into mitochondrial inner membrane Biological Process

GO:0045732 positive regulation of protein catabolic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0071300 cellular response to retinoic acid Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G04630

ath:AT2G33220

hsa:51079

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.955

Rank 1 · LXL04_014593 · OH-1004

Nucleus0.048

Rank 2 · LXL04_014593 · OH-1004

Cytoplasm0.043

Rank 3 · LXL04_014593 · OH-1004

Cell membrane0.019

Rank 4 · LXL04_014593 · OH-1004

Endoplasmic reticulum0.008

Rank 5 · LXL04_014593 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06212.18GRIM-1917-81 aa

PF06212.18GRIM-19158-275 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014593	`PF06212.18`	GRIM-19	17	81	8e-63	211.0
LXL04_014593	`PF06212.18`	GRIM-19	158	275	8e-63	211.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWA7`	Arabidopsis thaliana	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-A	83.916%	Swiss-Prot	moderate database homology
`O49313`	Arabidopsis thaliana	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-B	83.916%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card