LXL04_014581 | RubberDandelionOmics

Gene overview

LXL04_014581

Reference: OH-1004 Chr: Chr03 Coordinates: 53018898-53023140 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2133 bp · LXL04_014581|LXL04_014581|OH1004|cDNA

ATGTTGCTGGAGGTGGTGGTCGGCAGCAAACTGTTGTGGTCAGCAGCAACACCAGATCGAAAAATTGCACTCTGTGTATCACCGTCTTCCATCACGGGATCTACAAAGAACCCTAGTTTTTGTAAATCTGTACGAGATTATGATCACCTACCAACGACCCCTTTACTTTCAGTTTGTGACTCATTAGATCACCTCGCATATAATCTTGTGTTGCAGGTTATGGATTTTATGGACATTGATCAGGTAGTGGAGGTCCCCGA...

CDS

Download CDS FASTA

2133 bp · LXL04_014581|LXL04_014581|OH1004|CDS

ATGTTGCTGGAGGTGGTGGTCGGCAGCAAACTGTTGTGGTCAGCAGCAACACCAGATCGAAAAATTGCACTCTGTGTATCACCGTCTTCCATCACGGGATCTACAAAGAACCCTAGTTTTTGTAAATCTGTACGAGATTATGATCACCTACCAACGACCCCTTTACTTTCAGTTTGTGACTCATTAGATCACCTCGCATATAATCTTGTGTTGCAGGTTATGGATTTTATGGACATTGATCAGGTAGTGGAGGTCCCCGA...

Protein

Download Protein FASTA

710 aa · LXL04_014581|LXL04_014581|OH1004|PROTEIN

MLLEVVVGSKLLWSAATPDRKIALCVSPSSITGSTKNPSFCKSVRDYDHLPTTPLLSVCDSLDHLAYNLVLQVMDFMDIDQVVEVPDTPERFISTHSNDRNTPGTHSDGSSSCRVITKDSINETMRNDPREKGKSVKYHGSRRLFVRPDTNNSSSTSKNPFTTLHNAQKGESLSNSSLQNPAYRKSSSFVDLTDQNMHDRHVFEIDTLDTPVKSLGLNNTDKFGQRFDRGKGVITGGQHKVDHNSSMLTRLSRQKTLVIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014581`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014581

Location Chr03:53018898-53023140 (+)

Description Similar to SDIR1: E3 ubiquitin-protein ligase SDIR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55530`	E3 ubiquitin-protein ligase that acts as a positive regulator of abscisic acid-related stress signal transduction.	SDIR1 is a RING finger E3 ligase that positively regulates stress-responsive abscisic acid signaling in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048488 Arabidopsis SDIR1 enhances drought tolerance in crop plants.2008 · DOI: 10.1271/bbb.80286 The RING finger ubiquitin E3 ligase SDIR1 targets SDIR1-INTERACTING PROTEIN1 for degradation to modulate the salt stress response and ABA signaling in Arabidopsis.2015 · DOI: 10.1105/tpc.114.134163
`At3g47990`	E3 ubiquitin protein ligase that acts as a positive regulator of sugar signaling during early seedling development.	SUGAR-INSENSITIVE3, a RING E3 ligase, is a new player in plant sugar response.2010 · DOI: 10.1104/pp.109.150573
`At5g66070`	May be involved in the early steps of the plant defense signaling pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014581 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000578 embryonic axis specification Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT3G47990

ath:AT3G55530

ath:AT5G66070

hsa:51132

xla:398680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.873

Rank 1 · LXL04_014581 · OH-1004

Cytoplasm0.227

Rank 2 · LXL04_014581 · OH-1004

Cell membrane0.033

Rank 3 · LXL04_014581 · OH-1004

Endoplasmic reticulum0.021

Rank 4 · LXL04_014581 · OH-1004

Mitochondrion0.020

Rank 5 · LXL04_014581 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_2663-706 aa

PF12678.14zf-rbx1663-706 aa

PF17123.12zf-RING_11664-692 aa

PF13923.13zf-C3HC4_2664-705 aa

PF00097.32zf-C3HC4665-705 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014581	`PF13639.13`	zf-RING_2	663	706	2.8e-13	50.6
LXL04_014581	`PF12678.14`	zf-rbx1	663	706	4.6e-08	33.9
LXL04_014581	`PF17123.12`	zf-RING_11	664	692	3.7e-09	36.8
LXL04_014581	`PF13923.13`	zf-C3HC4_2	664	705	5.9e-09	36.3
LXL04_014581	`PF00097.32`	zf-C3HC4	665	705	3.3e-08	34.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2S6`	Arabidopsis thaliana	E3 ubiquitin-protein ligase SDIR1	36.975%	Swiss-Prot	weak database homology
`Q8GYT9`	Arabidopsis thaliana	E3 ubiquitin-protein ligase SIS3	48.529%	Swiss-Prot	weak database homology
`Q9FKX5`	Arabidopsis thaliana	NEP1-interacting protein-like 1	43.284%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card