RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_014527
Reference: OH-1004 Chr: Chr03 Coordinates: 51618331-51621365 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2790 bp · LXL04_014527|LXL04_014527|OH1004|cDNA

ATGGCACATGAAGATGCCAACCACCACAGCTACCGTCTCATCCTCTGTCTCCTCTCCTGCCTCCTCCTCCTCTCTCTCTCCGCCGCCGATGATGCATCCGTCATGTCTAAGCTCGCCACCTCCATCTCTCCAAACCCATCCAACTGGGACGGCGCTGACTTCTGTAACTGGGATGGAATCAACTGTGACAACACCAAACGTGTCACCGCCATTAATCTTGCTTCCAAATCCCTCACCGGAAACCTCCCTCCCGACCTGAA...

CDS

Download CDS FASTA

2790 bp · LXL04_014527|LXL04_014527|OH1004|CDS

ATGGCACATGAAGATGCCAACCACCACAGCTACCGTCTCATCCTCTGTCTCCTCTCCTGCCTCCTCCTCCTCTCTCTCTCCGCCGCCGATGATGCATCCGTCATGTCTAAGCTCGCCACCTCCATCTCTCCAAACCCATCCAACTGGGACGGCGCTGACTTCTGTAACTGGGATGGAATCAACTGTGACAACACCAAACGTGTCACCGCCATTAATCTTGCTTCCAAATCCCTCACCGGAAACCTCCCTCCCGACCTGAA...

Protein

Download Protein FASTA

929 aa · LXL04_014527|LXL04_014527|OH1004|PROTEIN

MAHEDANHHSYRLILCLLSCLLLLSLSAADDASVMSKLATSISPNPSNWDGADFCNWDGINCDNTKRVTAINLASKSLTGNLPPDLNQLSQLKTLSLQSNSLSGDLPTLANLTFLEKVFLDSNNFTSIPPDFFLGLSNLQEFSISDNLDLSPWVLPNHLTDSSNLQTFQASNAHIMGTIPDIFDSFPNLQNLRLSYNNLTGSLPKSFGGSEIQNLWLNNQDAGLSGTLDVLSSMSQLYQVWLQANAFTGAIPDLSKCTNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_014527
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_014527
LocationChr03:51618331-51621365 (+)
DescriptionSimilar to TMK4: Receptor-like kinase TMK4
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g23750 Involved in auxin signal transduction and cell expansion and proliferation regulation.
Identification of Arabidopsis BAK1-associating receptor-like kinase 1 (BARK1) and characterization of its gene expression and brassinosteroid-regulated root phenotypes.2013 · DOI: 10.1093/pcp/pct106
At2g01820 Involved in auxin signal transduction and cell expansion and proliferation regulation. No verified direct reference in this release
At1g66150 Transmembrane kinase receptor.
The TMK1 gene from Arabidopsis codes for a protein with structural and biochemical characteristics of a receptor protein kinase.1992 · DOI: 10.1105/tpc.4.10.1263
Receptor-like kinase activity in membranes of Arabidopsis thaliana.1993 · DOI: 10.1016/0014-5793(93)80676-l
At1g24650 Involved in auxin signal transduction and cell expansion and proliferation regulation. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os11g0448000 Transmembrane kinase receptor involved in the regulation of reactive oxygen species (ROS) homeostasis, chloroplast development and leaf senescence.
WATER-SOAKED SPOT1 Controls Chloroplast Development and Leaf Senescence via Regulating Reactive Oxygen Species Homeostasis in Rice.2022 · DOI: 10.3389/fpls.2022.918673
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_014527 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0007165 signal transduction Biological Process
GO:0009555 pollen development Biological Process
GO:0009658 chloroplast organization Biological Process
GO:0010600 regulation of auxin biosynthetic process Biological Process
GO:0010928 regulation of auxin mediated signaling pathway Biological Process
GO:1900055 regulation of leaf senescence Biological Process
GO:2000377 regulation of reactive oxygen species metabolic process Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference
ath:AT1G24650
ath:AT1G66150
ath:AT2G01820
ath:AT3G23750
dosa:Os11g0448000
osa:4350438
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.877
Rank 1 · LXL04_014527 · OH-1004
Endoplasmic reticulum0.076
Rank 2 · LXL04_014527 · OH-1004
Cytoplasm0.073
Rank 3 · LXL04_014527 · OH-1004
Nucleus0.046
Rank 4 · LXL04_014527 · OH-1004
Lysosome / Vacuole0.027
Rank 5 · LXL04_014527 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_1484-294 aa
PF13855.13LRR_8115-167 aa
PF13855.13LRR_8236-294 aa
PF08263.18LRRNT_2323-361 aa
PF13855.13LRR_8366-425 aa
PF12799.14LRR_4389-433 aa
PF00069.32Pkinase582-855 aa
PF07714.24PK_Tyr_Ser-Thr584-856 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_014527PF23598.2LRR_14842942.2e-0627.4
LXL04_014527PF13855.13LRR_81151676.3e-2381.0
LXL04_014527PF13855.13LRR_82362946.3e-2381.0
LXL04_014527PF08263.18LRRNT_23233613e-0937.7
LXL04_014527PF13855.13LRR_83664256.3e-2381.0
LXL04_014527PF12799.14LRR_43894335.3e-2174.9
LXL04_014527PF00069.32Pkinase5828557.5e-46157.4
LXL04_014527PF07714.24PK_Tyr_Ser-Thr5848563.1e-48165.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LK43Arabidopsis thalianaReceptor-like kinase TMK462.745%Swiss-Protstrong database homology
Q9SIT1Arabidopsis thalianaReceptor-like kinase TMK352.748%Swiss-Protstrong database homology
P43298Arabidopsis thalianaReceptor protein kinase TMK153.398%Swiss-Protstrong database homology
Q9FYK0Arabidopsis thalianaReceptor-like kinase TMK247.497%Swiss-Protmoderate database homology
Q2R560Oryza sativa subsp. japonicaReceptor protein kinase WSS148.840%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser