LXL04_014524 | RubberDandelionOmics

Gene overview

LXL04_014524

Reference: OH-1004 Chr: Chr03 Coordinates: 51525542-51527046 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

552 bp · LXL04_014524|LXL04_014524|OH1004|cDNA

ATGATGCGCCGTAAGCACACCTACGCTATCGCATGGGTGAATTCAAATGCCAAAGTCCGCTGTCCAATTCCATACCTATGCCGCCGATCGATTTTAAGGGAGAAACCTAATATGAAGTGGAATGATGTCGCTACAAGAAGCCGTTATCCTGCGGGGAAAAAGGTTGCCAGGCTAGAAGAGGAAGTAGTTAAGCTTGAGGCTTCTGGGGAGGCTGAGCTTAAGCTTCAAATCTCTGAACTTGAGACAAAAATGATGGtatt...

CDS

Download CDS FASTA

552 bp · LXL04_014524|LXL04_014524|OH1004|CDS

ATGATGCGCCGTAAGCACACCTACGCTATCGCATGGGTGAATTCAAATGCCAAAGTCCGCTGTCCAATTCCATACCTATGCCGCCGATCGATTTTAAGGGAGAAACCTAATATGAAGTGGAATGATGTCGCTACAAGAAGCCGTTATCCTGCGGGGAAAAAGGTTGCCAGGCTAGAAGAGGAAGTAGTTAAGCTTGAGGCTTCTGGGGAGGCTGAGCTTAAGCTTCAAATCTCTGAACTTGAGACAAAAATGATGGTATT...

Protein

Download Protein FASTA

183 aa · LXL04_014524|LXL04_014524|OH1004|PROTEIN

MMRRKHTYAIAWVNSNAKVRCPIPYLCRRSILREKPNMKWNDVATRSRYPAGKKVARLEEEVVKLEASGEAELKLQISELETKMMVLLMSLKAGGVGINLTAASNAFVMEFDENFKSVVARMTLKYEQLNLMANVSNSKSGTTLVRTFLKGSEWRGKLWEIKTVEMKGSGKVKVQVNEHGLQV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014524`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014524

Location Chr03:51525542-51527046 (+)

Description Similar to RAD5A: DNA repair protein RAD5A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22750`	Functions in error-free postreplication DNA repair or DNA- damage tolerance (DTT) pathway.	A homolog of ScRAD5 is involved in DNA repair and homologous recombination in Arabidopsis.2008 · DOI: 10.1104/pp.108.116806 RAD5A, RECQ4A, and MUS81 have specific functions in homologous recombination and define different pathways of DNA repair in Arabidopsis thaliana.2010 · DOI: 10.1105/tpc.110.078568 RAD5a and REV3 function in two alternative pathways of DNA-damage tolerance in Arabidopsis.2011 · DOI: 10.1016/j.dnarep.2011.04.009 AtRAD5A is a DNA translocase harboring a HIRAN domain which confers binding to branched DNA structures and is required for DNA repair in vivo.2016 · DOI: 10.1111/tpj.13283

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014524 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006325 chromatin organization Biological Process

GO:0009294 DNA-mediated transformation Biological Process

GO:0036297 interstrand cross-link repair Biological Process

GO:0045003 double-strand break repair via synthesis-dependent strand annealing Biological Process

GO:0005634 nucleus Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0004386 helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008094 ATP-dependent activity, acting on DNA Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G22750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.523

Rank 1 · LXL04_014524 · OH-1004

Cytoplasm0.330

Rank 2 · LXL04_014524 · OH-1004

Mitochondrion0.111

Rank 3 · LXL04_014524 · OH-1004

Cell membrane0.056

Rank 4 · LXL04_014524 · OH-1004

Endoplasmic reticulum0.044

Rank 5 · LXL04_014524 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNI6`	Arabidopsis thaliana	DNA repair protein RAD5A	80.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card