LXL04_014521 | RubberDandelionOmics

Gene overview

LXL04_014521

Reference: OH-1004 Chr: Chr03 Coordinates: 51497262-51498395 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

843 bp · LXL04_014521|LXL04_014521|OH1004|cDNA

ATGGAATCTTTTAGTAATGGGTACTCAAAACCTCTCTCTTTAACTATTCTAATGGCGGCACTAAGCTCTTTCCTCATGGTCGCGTCCGCCGGGAACTTTTATCAAGATTTTGATCTCACTTGGGGCGATCATCGGGCCAAGATTTTCAATGGAGGCCAGCTTCTTTCACTCTCGTTGGATAAAGTTTCTGGGTCGGGTTTTAAGTCCAAGAATGAGTATTTGTTTGGAAGAATCGATATGCAACTCAAGCTTGTTTCCGG...

CDS

Download CDS FASTA

843 bp · LXL04_014521|LXL04_014521|OH1004|CDS

ATGGAATCTTTTAGTAATGGGTACTCAAAACCTCTCTCTTTAACTATTCTAATGGCGGCACTAAGCTCTTTCCTCATGGTCGCGTCCGCCGGGAACTTTTATCAAGATTTTGATCTCACTTGGGGCGATCATCGGGCCAAGATTTTCAATGGAGGCCAGCTTCTTTCACTCTCGTTGGATAAAGTTTCTGGGTCGGGTTTTAAGTCCAAGAATGAGTATTTGTTTGGAAGAATCGATATGCAACTCAAGCTTGTTTCCGG...

Protein

Download Protein FASTA

280 aa · LXL04_014521|LXL04_014521|OH1004|PROTEIN

MESFSNGYSKPLSLTILMAALSSFLMVASAGNFYQDFDLTWGDHRAKIFNGGQLLSLSLDKVSGSGFKSKNEYLFGRIDMQLKLVSGNSAGTVTAYYLSSEGPTHDEIDFEFLGNTTGDPYILHTNVFTQGKGNREQQFYLWFDPTKNFHTYSIIWDSRKIVFLVDNTPIRVFANAERKGVPFPKNQPMKIYSSLWNADDWATRGGLVKTDWAKAPFTAYYRNFNVQKSATSRFLNGAWQSQELDAYSRRRLRWVQKNFM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014521`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014521

Location Chr03:51497262-51498395 (+)

Description Similar to Xyloglucan endotransglucosylase/hydrolase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23730`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At4g14130`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	Distinct catalytic capacities of two aluminium-repressed Arabidopsis thaliana xyloglucan endotransglucosylase/hydrolases, XTH15 and XTH31, heterologously produced in Pichia.2015 · DOI: 10.1016/j.phytochem.2014.09.020
`At4g25810`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014521 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0009835 fruit ripening Biological Process

GO:0010218 response to far red light Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Molecular Function

GO:0016762 xyloglucan:xyloglucosyl transferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G23730

ath:AT4G14130

ath:AT4G25810

gmx:547802

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.404

Rank 1 · LXL04_014521 · OH-1004

Lysosome / Vacuole0.201

Rank 2 · LXL04_014521 · OH-1004

Golgi apparatus0.135

Rank 3 · LXL04_014521 · OH-1004

Cell membrane0.113

Rank 4 · LXL04_014521 · OH-1004

Cytoplasm0.109

Rank 5 · LXL04_014521 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00722.29Glyco_hydro_1634-214 aa

PF06955.20XET_C238-279 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014521	`PF00722.29`	Glyco_hydro_16	34	214	1.6e-67	227.0
LXL04_014521	`PF06955.20`	XET_C	238	279	1.1e-20	73.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LG58`	Arabidopsis thaliana	Probable xyloglucan endotransglucosylase/hydrolase protein 16	73.145%	Swiss-Prot	strong database homology
`Q38911`	Arabidopsis thaliana	Xyloglucan endotransglucosylase/hydrolase protein 15	71.831%	Swiss-Prot	strong database homology
`Q38910`	Arabidopsis thaliana	Probable xyloglucan endotransglucosylase/hydrolase protein 23	64.855%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card