LXL04_014517 | RubberDandelionOmics

Gene overview

LXL04_014517

Reference: OH-1004 Chr: Chr03 Coordinates: 51427783-51432788 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3846 bp · LXL04_014517|LXL04_014517|OH1004|cDNA

ATGCAGTACATCGGCTCCGATCATCATCAACGGTCAGACTCCGATCAACAACTCCGGGAACGGCAATACCTAACATGCTCACAAGGCCATACTTCGTCTCTAATACTGCAGACCTTAGAAGGCGGATCGATCTGCTTAGTCTGTCTATCGAATCTGATCTCAAATCCTAATTCCCCTACCGTTCACGTCTCTTACGCCCTCTCTCAGCTCTCTCAGGCCATATCTCAACCTCATTTCCTACACAATCTCGTCACCTTTCA...

CDS

Download CDS FASTA

3846 bp · LXL04_014517|LXL04_014517|OH1004|CDS

ATGCAGTACATCGGCTCCGATCATCATCAACGGTCAGACTCCGATCAACAACTCCGGGAACGGCAATACCTAACATGCTCACAAGGCCATACTTCGTCTCTAATACTGCAGACCTTAGAAGGCGGATCGATCTGCTTAGTCTGTCTATCGAATCTGATCTCAAATCCTAATTCCCCTACCGTTCACGTCTCTTACGCCCTCTCTCAGCTCTCTCAGGCCATATCTCAACCTCATTTCCTACACAATCTCGTCACCTTTCA...

Protein

Download Protein FASTA

1281 aa · LXL04_014517|LXL04_014517|OH1004|PROTEIN

MQYIGSDHHQRSDSDQQLRERQYLTCSQGHTSSLILQTLEGGSICLVCLSNLISNPNSPTVHVSYALSQLSQAISQPHFLHNLVTFHPHFLVSPLITALSSLEDEPLAKQMIDLISELCSSGDCSIYSEFVARVSDRLSSGSLAWSRHQIYMLHCLGVLLDNQKNDPYLHIKERDKLILNLATGLQLPSEEIQGEILFVLYKICGIQHASIGNSNGDVLYDHSSKILHLSLEVLLKTQRDDVRLNCLALLSVLTRKGFFE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014517`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014517

Location Chr03:51427783-51432788 (+)

Description Similar to PRD1: Protein PUTATIVE RECOMBINATION INITIATION DEFECT 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14180`	Involved in DNA cleavage that forms the double-strand breaks (DSB) that initiate meiotic recombination.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014517 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0042138 meiotic DNA double-strand break formation Biological Process

GO:0051026 chiasma assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT4G14180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.433

Rank 1 · LXL04_014517 · OH-1004

Cytoplasm0.423

Rank 2 · LXL04_014517 · OH-1004

Endoplasmic reticulum0.111

Rank 3 · LXL04_014517 · OH-1004

Golgi apparatus0.104

Rank 4 · LXL04_014517 · OH-1004

Cell membrane0.088

Rank 5 · LXL04_014517 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30261.1TPR_PRD1_N26-576 aa

PF26724.1TPR_PRD1581-782 aa

PF30216.1TPR_PRD1_C795-1264 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014517	`PF30261.1`	TPR_PRD1_N	26	576	7.1e-246	818.0
LXL04_014517	`PF26724.1`	TPR_PRD1	581	782	6.5e-81	271.5
LXL04_014517	`PF30216.1`	TPR_PRD1_C	795	1264	1.2e-183	612.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23277`	Arabidopsis thaliana	Protein PUTATIVE RECOMBINATION INITIATION DEFECT 1	44.106%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card