Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1698 bp · LXL04_014345|LXL04_014345|OH1004|cDNA
ATGGATATTGGCACATCTGGTTCTTCCTATGCTAACTTTGTGGTACCTTTTATGATATGCGAATGCACACATGGACATGCTGAGATGTCAATTACTACGAGTCAACTAAAGTCAAAAGCCATGTCAGCAAGTTTTACTGAGAAACCAGTTGTCGATTGCAAAACTGAACCAGTATTATCACCAAAGCATGTCTTCTTCTCAACCAAAACCAAAGCCAGAAAATCAAAACCAAAAGCCAAGAACACTCCCTCACCAAACCT...
1698 bp · LXL04_014345|LXL04_014345|OH1004|CDS
ATGGATATTGGCACATCTGGTTCTTCCTATGCTAACTTTGTGGTACCTTTTATGATATGCGAATGCACACATGGACATGCTGAGATGTCAATTACTACGAGTCAACTAAAGTCAAAAGCCATGTCAGCAAGTTTTACTGAGAAACCAGTTGTCGATTGCAAAACTGAACCAGTATTATCACCAAAGCATGTCTTCTTCTCAACCAAAACCAAAGCCAGAAAATCAAAACCAAAAGCCAAGAACACTCCCTCACCAAACCT...
Protein
Download Protein FASTA565 aa · LXL04_014345|LXL04_014345|OH1004|PROTEIN
MDIGTSGSSYANFVVPFMICECTHGHAEMSITTSQLKSKAMSASFTEKPVVDCKTEPVLSPKHVFFSTKTKARKSKPKAKNTPSPNLNQPISSTHQQQPQSFYRNIQDQLMYSPQHYHMPPNMYGYPSNYMSYQMPLQNIQPQNQPQTQNQPQNQTQMQHQNLDDFNLYDPNFLTQFQTQMQHQSQSQSQPQPQQPFQTTQPRRLCDEESSNEDEEEVNFNYNLEDEDDEPEPEPEPEPEPEPPSRKRGKGKGKEKEPVQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014345 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014345 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:46868283-46875355 (-) | ||||||||||||
| Description | Similar to GC1: Golgin candidate 1 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000301 retrograde transport, vesicle recycling within Golgi Biological Process GO:0007030 Golgi organization Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0031985 Golgi cisterna Cellular Component GO:0030674 protein-macromolecule adaptor activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT2G19950 dosa:Os01g0744400 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.