Gene Card
Gene overview
cDNA / CDS / Protein Sequences
885 bp · LXL04_014329|LXL04_014329|OH1004|cDNA
ATGGCGTCGGAGTTTGAGAAGAAGCGGACGGGAAGGTTTTGGCTCAGAAAATGGGATTTAGAAGACGTGGCCAGCATTTGCTGGTTTACCGTGATACATTTGTTGGCTGCTTGTGCACTTTTCGTGTATGATCGGGGCGCAATCAGGTTATGTGTGAGCTTCGCTTTACTGAGTGCGTTTGGAATAACCTTTGGTTATAATAGACTTCTTTGTCACCATACTTTCAAGATCCCAAAATGGCTGGAGTATTTCTTCGTTTA...
885 bp · LXL04_014329|LXL04_014329|OH1004|CDS
ATGGCGTCGGAGTTTGAGAAGAAGCGGACGGGAAGGTTTTGGCTCAGAAAATGGGATTTAGAAGACGTGGCCAGCATTTGCTGGTTTACCGTGATACATTTGTTGGCTGCTTGTGCACTTTTCGTGTATGATCGGGGCGCAATCAGGTTATGTGTGAGCTTCGCTTTACTGAGTGCGTTTGGAATAACCTTTGGTTATAATAGACTTCTTTGTCACCATACTTTCAAGATCCCAAAATGGCTGGAGTATTTCTTCGTTTA...
Protein
Download Protein FASTA294 aa · LXL04_014329|LXL04_014329|OH1004|PROTEIN
MASEFEKKRTGRFWLRKWDLEDVASICWFTVIHLLAACALFVYDRGAIRLCVSFALLSAFGITFGYNRLLCHHTFKIPKWLEYFFVYCGAHAFQIQLMFYVNTHRNHHKYADTNRDPVTPTRDGFWYCNMGWFFDNDHIAAKCGESRAGKYSKVPELKAQWFYRFLHDTYFWHPTALSALLYLHGGFPYLAWAMGMRAVVIHHFAALASYVSHKWGERPWNTLDTSTNKWWVAVLTLGEGWHNNHHAFPRSARHGMEWWQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014329 |
|---|---|
| TK1151 ID | TkA02G439050 |
| OH-1004 ID | LXL04_014329 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 98.404 / OH-1004 62.925Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014329 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:46238911-46247332 (-) | |||||||||
| Description | Similar to AL10: Acyl-CoA C20 Delta5-desaturase | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006633 fatty acid biosynthetic process Biological Process GO:0006636 unsaturated fatty acid biosynthetic process Biological Process GO:0010205 photoinhibition Biological Process GO:0031408 oxylipin biosynthetic process Biological Process GO:0042761 very long-chain fatty acid biosynthetic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009579 thylakoid Cellular Component GO:0031969 chloroplast membrane Cellular Component GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water Molecular Function GO:0046872 metal ion binding Molecular Function | |||||||||
| KEGG gene cross-reference | ag:AAG28599 ath:AT1G06080 ath:AT3G15850 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00487.31FA_desaturase50-268 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_014329 | PF00487.31 | FA_desaturase | 50 | 268 | 1.1e-18 | 68.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.