LXL04_014322 | RubberDandelionOmics

Gene overview

LXL04_014322

Reference: OH-1004 Chr: Chr03 Coordinates: 46172911-46174984 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1287 bp · LXL04_014322|LXL04_014322|OH1004|cDNA

ATGACAGAGGTCCTCCATTCcccatcttcatcttcttcctctcTGCAAACCCACAACGACACTGCATTGTTTCAGTATGTAAATCAAGAACCGGAAGAATCAGGAGAAAGGGTTTCTAGGGTTCCAGATTGCGACGAAGACGACAATGAATTGAATGTTCGAAGAGAAAGGGATAATCAACAGCTGTCGTTACTGGCACTTTTGTTTACCCTATTCAGGAAATCGTTCTGGGTTGCTGCTTCTTGCAAGACCACGGCTGC...

CDS

Download CDS FASTA

1287 bp · LXL04_014322|LXL04_014322|OH1004|CDS

ATGACAGAGGTCCTCCATTCCCCATCTTCATCTTCTTCCTCTCTGCAAACCCACAACGACACTGCATTGTTTCAGTATGTAAATCAAGAACCGGAAGAATCAGGAGAAAGGGTTTCTAGGGTTCCAGATTGCGACGAAGACGACAATGAATTGAATGTTCGAAGAGAAAGGGATAATCAACAGCTGTCGTTACTGGCACTTTTGTTTACCCTATTCAGGAAATCGTTCTGGGTTGCTGCTTCTTGCAAGACCACGGCTGC...

Protein

Download Protein FASTA

428 aa · LXL04_014322|LXL04_014322|OH1004|PROTEIN

MTEVLHSPSSSSSSLQTHNDTALFQYVNQEPEESGERVSRVPDCDEDDNELNVRRERDNQQLSLLALLFTLFRKSFWVAASCKTTAAEHKQDLSAMEIGWPTNVRHVAHVTFDRFNGFLGLPVEFEPEVPRRAPSASATVFGVSTESMQLSHDFRGNSIPTILLLMQHRLYSQGGLQAEGVFRINAENSQEEHLRNQLNSGVVPDGIDVHCLAGLIKAWFRELPTGVLDPLSPEQVMQCQSEEDCAALVRLLPLTEAALL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014322`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014322

Location Chr03:46172911-46174984 (-)

Description Similar to ROPGAP1: Rho GTPase-activating protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g22400`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	No verified direct reference in this release
`At3g11490`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	RopGAP4-dependent Rop GTPase rheostat control of Arabidopsis oxygen deprivation tolerance.2002 · DOI: 10.1126/science.1071505
`At1g08340`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	No verified direct reference in this release
`At2g46710`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	No verified direct reference in this release
`At4g03100`	Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014322 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0034059 response to anoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009531 secondary cell wall Cellular Component

GO:0005096 GTPase activator activity Molecular Function

KEGG gene cross-reference

ath:AT1G08340

ath:AT2G46710

ath:AT3G11490

ath:AT4G03100

ath:AT5G22400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.506

Rank 1 · LXL04_014322 · OH-1004

Nucleus0.251

Rank 2 · LXL04_014322 · OH-1004

Cell membrane0.197

Rank 3 · LXL04_014322 · OH-1004

Mitochondrion0.152

Rank 4 · LXL04_014322 · OH-1004

Golgi apparatus0.132

Rank 5 · LXL04_014322 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00620.33RhoGAP162-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014322	`PF00620.33`	RhoGAP	162	294	3.5e-22	79.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMR1`	Arabidopsis thaliana	Rho GTPase-activating protein 1	62.371%	Swiss-Prot	strong database homology
`Q9CAX8`	Arabidopsis thaliana	Rho GTPase-activating protein 4	66.450%	Swiss-Prot	strong database homology
`Q6NKT5`	Arabidopsis thaliana	Rho GTPase-activating protein 5	78.166%	Swiss-Prot	moderate database homology
`Q8GYY5`	Arabidopsis thaliana	Rho GTPase-activating protein 3	69.288%	Swiss-Prot	moderate database homology
`F4JI46`	Arabidopsis thaliana	Rho GTPase-activating protein 2	64.014%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card