LXL04_014254 | RubberDandelionOmics

Gene overview

LXL04_014254

Reference: OH-1004 Chr: Chr03 Coordinates: 44619474-44621311 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

960 bp · LXL04_014254|LXL04_014254|OH1004|cDNA

ATGAAATCAGTGGAGAGGAATCCAATGGAAATCAATAACCGCTTGGCCCCTTTACAGTCAAATGCAGTTTCAATCACTTCTTCACAGGAGTATGGATGCTTAAGGAAAAAGAAAATAGATGAACTTACCGAGGTGCAAAATGATGTCCAGTATATAAAAGAGGACATTAGTTTGGTGGAAAGACATAGAATCAACTTGTATAGAGCTAGAGATAGGTATTTAGTGAAAATGCCAGTGCATGGTGGTGAGCTGACAGGTTC...

CDS

Download CDS FASTA

960 bp · LXL04_014254|LXL04_014254|OH1004|CDS

ATGAAATCAGTGGAGAGGAATCCAATGGAAATCAATAACCGCTTGGCCCCTTTACAGTCAAATGCAGTTTCAATCACTTCTTCACAGGAGTATGGATGCTTAAGGAAAAAGAAAATAGATGAACTTACCGAGGTGCAAAATGATGTCCAGTATATAAAAGAGGACATTAGTTTGGTGGAAAGACATAGAATCAACTTGTATAGAGCTAGAGATAGGTATTTAGTGAAAATGCCAGTGCATGGTGGTGAGCTGACAGGTTC...

Protein

Download Protein FASTA

319 aa · LXL04_014254|LXL04_014254|OH1004|PROTEIN

MKSVERNPMEINNRLAPLQSNAVSITSSQEYGCLRKKKIDELTEVQNDVQYIKEDISLVERHRINLYRARDRYLVKMPVHGGELTGSKTWSSSSINKDTILFPSGKPQGSTQMKEASSGLSSQHTNQSSLAVTRKKRVQSQFNDLQHCYLQNRRQVPNPLQNHDKRDDDVIQREGIVQVYQIFNLYFPLLHNIGNLSIYISIIISIFVRLRVIAELRHGELFHSANIVSRLNEPPEVHCPVVEMPTISKLSCLSWNKHTK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014254`
TK1151 ID	TkA01G503710
OH-1004 ID	LXL04_014254
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.500
Protein coverage (%)	TK1151 83.140 / OH-1004 44.828 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014254

Location Chr03:44619474-44621311 (+)

Description Similar to COP1: E3 ubiquitin-protein ligase COP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32950`	E3 ubiquitin-protein ligase that acts as a repressor of photomorphogenesis and as an activator of etiolation in darkness.	Two interacting bZIP proteins are direct targets of COP1-mediated control of light-dependent gene expression in Arabidopsis.2002 · DOI: 10.1101/gad.969702 Short Hypocotyl in White Light1 Interacts with Elongated Hypocotyl5 (HY5) and Constitutive Photomorphogenic1 (COP1) and Promotes COP1-Mediated Degradation of HY5 during Arabidopsis Seedling Development.2015 · DOI: 10.1104/pp.15.01184 PHYTOCHROME INTERACTING FACTOR8 Inhibits Phytochrome A-Mediated Far-Red Light Responses in Arabidopsis.2020 · DOI: 10.1105/tpc.19.00515 Role of a COP1 interactive protein in mediating light-regulated gene expression in arabidopsis.1998 · DOI: 10.1105/tpc.10.7.1083
`UniProt: Q9SYX2`	Controls normal photoperiodic flowering and regulates circadian rhythms.	No verified direct reference in this release
`At1g53090`	Repressor of photomorphogenesis in the light.	The SPA1-like proteins SPA3 and SPA4 repress photomorphogenesis in the light.2003 · DOI: 10.1046/j.1365-313x.2003.01813.x Functional and expression analysis of Arabidopsis SPA genes during seedling photomorphogenesis and adult growth.2006 · DOI: 10.1111/j.1365-313x.2006.02812.x Arabidopsis SPA proteins regulate photoperiodic flowering and interact with the floral inducer CONSTANS to regulate its stability.2006 · DOI: 10.1242/dev.02481

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014254 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009637 response to blue light Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009641 shade avoidance Biological Process

GO:0009647 skotomorphogenesis Biological Process

GO:0009649 entrainment of circadian clock Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009963 positive regulation of flavonoid biosynthetic process Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010100 negative regulation of photomorphogenesis Biological Process

KEGG gene cross-reference

ath:AT1G53090

ath:AT2G32950

ath:AT2G46340

hsa:64326

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.454

Rank 1 · LXL04_014254 · OH-1004

Cytoplasm0.429

Rank 2 · LXL04_014254 · OH-1004

Cell membrane0.074

Rank 3 · LXL04_014254 · OH-1004

Mitochondrion0.063

Rank 4 · LXL04_014254 · OH-1004

Golgi apparatus0.059

Rank 5 · LXL04_014254 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P43254`	Arabidopsis thaliana	E3 ubiquitin-protein ligase COP1	47.164%	Swiss-Prot	moderate database homology
`Q9SYX2`	Arabidopsis thaliana	Protein SUPPRESSOR OF PHYA-105 1	33.824%	Swiss-Prot	weak database homology
`Q94BM7`	Arabidopsis thaliana	Protein SPA1-RELATED 4	34.559%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card