Gene Card
Gene overview
cDNA / CDS / Protein Sequences
4140 bp · LXL04_014221|LXL04_014221|OH1004|cDNA
ATGCAAATGCCAAAATCCAGATTGAATTTATCAACACAAGAAGCATTGTCAACATCCCCAAGAGCAAGGGAGGTTGAAGGTCCTTCAAGATGGAGTGAATACTTGAATCAGGAAACGGGCACTCCAATGCCTTCTAGAACCTCCCGGAACAATGGATCAGAAGTATCATTCCAGCTTCCTGGAGTATCTCATAAGGGATTAAACGTGCAGTGGGTATATCAACTTACCCAAGTTGCACAAGGACTAATGGCCAAAATCTA...
4140 bp · LXL04_014221|LXL04_014221|OH1004|CDS
ATGCAAATGCCAAAATCCAGATTGAATTTATCAACACAAGAAGCATTGTCAACATCCCCAAGAGCAAGGGAGGTTGAAGGTCCTTCAAGATGGAGTGAATACTTGAATCAGGAAACGGGCACTCCAATGCCTTCTAGAACCTCCCGGAACAATGGATCAGAAGTATCATTCCAGCTTCCTGGAGTATCTCATAAGGGATTAAACGTGCAGTGGGTATATCAACTTACCCAAGTTGCACAAGGACTAATGGCCAAAATCTA...
Protein
Download Protein FASTA1379 aa · LXL04_014221|LXL04_014221|OH1004|PROTEIN
MQMPKSRLNLSTQEALSTSPRAREVEGPSRWSEYLNQETGTPMPSRTSRNNGSEVSFQLPGVSHKGLNVQWVYQLTQVAQGLMAKIYRLNQILDYPDSVNHVFTEAFWKAGVFPNCPKICTLLSKKFPEHHGKLQLERVDKVALDALNDQAEAHLQSLEPWIQLLLDIVAFREQALRLILDLSSTVITLLPHQNSLILHAFMDLFCSFVRVNLFAEKLPRKMMVQVYNLLHAILRNDRDCDFYYRLVQFIDAYDPPLKGL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014221 |
|---|---|
| TK1151 ID | TkA02G446860 |
| OH-1004 ID | LXL04_014221 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.800 |
| Protein coverage (%) | TK1151 91.002 / OH-1004 32.270Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014221 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:43893741-43899942 (-) | ||||||||||||
| Description | Similar to NAP1: Protein NAP1 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000281 mitotic cytokinesis Biological Process GO:0000902 cell morphogenesis Biological Process GO:0006972 hyperosmotic response Biological Process GO:0007015 actin filament organization Biological Process GO:0007155 cell adhesion Biological Process GO:0007354 zygotic determination of anterior/posterior axis, embryo Biological Process GO:0008064 regulation of actin polymerization or depolymerization Biological Process GO:0008078 mesodermal cell migration Biological Process GO:0009825 multidimensional cell growth Biological Process GO:0010090 trichome morphogenesis Biological Process GO:0010172 embryonic body morphogenesis Biological Process GO:0010592 positive regulation of lamellipodium assembly Biological Process | ||||||||||||
| KEGG gene cross-reference | ath:AT2G35110 ddi:DDB_G0274519 nve:5517043 rno:58823 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF09735.15Nckap175-1263 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_014221 | PF09735.15 | Nckap1 | 75 | 1263 | 1.5e-295 | 984.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.