LXL04_014213 | RubberDandelionOmics

Gene overview

LXL04_014213

Reference: OH-1004 Chr: Chr03 Coordinates: 43805757-43807205 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

612 bp · LXL04_014213|LXL04_014213|OH1004|cDNA

ATGGCGAGAACCAAACAACCTGCTAAACGGAGTGCGGGCAATCGAACACCTGGTCAATATCTCCCTCTCTTGCTCTCTGATCTTCTTTATGTTCAAACCCTAATTTTTATTCCCTTCTCTTTCAAGTTGCAGCTCAAGCATCAACTTCAACTTCAACCAGTACGCCGCGAAGAAGTCCGAGAAAGGTTCCAGGGAGTGAGTTCGGGAACGGGAGAAAGGCAGAAACAGAAACCCCATCGTTTTAAGCCTGGTACTCAGGC...

CDS

Download CDS FASTA

612 bp · LXL04_014213|LXL04_014213|OH1004|CDS

ATGGCGAGAACCAAACAACCTGCTAAACGGAGTGCGGGCAATCGAACACCTGGTCAATATCTCCCTCTCTTGCTCTCTGATCTTCTTTATGTTCAAACCCTAATTTTTATTCCCTTCTCTTTCAAGTTGCAGCTCAAGCATCAACTTCAACTTCAACCAGTACGCCGCGAAGAAGTCCGAGAAAGGTTCCAGGGAGTGAGTTCGGGAACGGGAGAAAGGCAGAAACAGAAACCCCATCGTTTTAAGCCTGGTACTCAGGC...

Protein

Download Protein FASTA

203 aa · LXL04_014213|LXL04_014213|OH1004|PROTEIN

MARTKQPAKRSAGNRTPGQYLPLLLSDLLYVQTLIFIPFSFKLQLKHQLQLQPVRREEVRERFQGVSSGTGERQKQKPHRFKPGTQALREIRRLQKTVNLLIPVAPFVRTVKEISNYIAPEVTRWQAEALQCLQEAAEDYLIQLFEDSMLCAIHAKRVTLSKFFFNGTLIGCARDTCPHHLFKFIVQKDLALARRLTKKGQPW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014213`
TK1151 ID	TkA02G447190
OH-1004 ID	LXL04_014213
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	66.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014213

Location Chr03:43805757-43807205 (+)

Description Similar to HTR12: Histone H3-like centromeric protein HTR12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01370`	Histone H3-like variant which exclusively replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0489800`	Histone H3-like variant which exclusively replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore.	Sequencing of a rice centromere uncovers active genes.2004 · DOI: 10.1038/ng1289 Genomic and genetic characterization of rice Cen3 reveals extensive transcription and evolutionary implications of a complex centromere.2006 · DOI: 10.1105/tpc.106.043794

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014213 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0031507 heterochromatin formation Biological Process

GO:0034080 CENP-A containing chromatin assembly Biological Process

GO:0051301 cell division Biological Process

GO:0051307 meiotic chromosome separation Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0051382 kinetochore assembly Biological Process

GO:0051983 regulation of chromosome segregation Biological Process

GO:0000775 chromosome, centromeric region Cellular Component

GO:0000776 kinetochore Cellular Component

GO:0000785 chromatin Cellular Component

KEGG gene cross-reference

ath:AT1G01370

dha:DEHA2F02574g

dosa:Os05g0489800

hsa:391769

pic:PICST_69601

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.884

Rank 1 · LXL04_014213 · OH-1004

Cytoplasm0.177

Rank 2 · LXL04_014213 · OH-1004

Mitochondrion0.026

Rank 3 · LXL04_014213 · OH-1004

Cell membrane0.017

Rank 4 · LXL04_014213 · OH-1004

Endoplasmic reticulum0.013

Rank 5 · LXL04_014213 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00125.31Histone83-162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014213	`PF00125.31`	Histone	83	162	1.7e-22	80.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RVQ9`	Arabidopsis thaliana	Histone H3-like centromeric protein CENH3	50.000%	Swiss-Prot	moderate database homology
`Q6T367`	Oryza sativa subsp. japonica	Histone H3-like centromeric protein CENH3	48.921%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card