RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_014197
Reference: OH-1004 Chr: Chr03 Coordinates: 43438287-43440102 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1717 bp · LXL04_014197|LXL04_014197|OH1004|cDNA

TAACTTTGAAGCCCAGACTCCGATCTAAAGCAGGATATTTGGGGATGGCATGGCGGCCTTCTCCTTCCCCAAAACCGCATCAACATCCCTCACCCTCCTCCTCACTTtgatcttcttcttccttcttcaaTTCCCCTCATCAAACGATCACCACCGTTTCCAATCTCACCGGAGGTCACTCCTCAACACTACGACCACCACCACTTGTTCACACATTCTTCAAATCCCACAAGATCACCGCTGCTTCTTCTCCACCGACC...

CDS

Download CDS FASTA

1668 bp · LXL04_014197|LXL04_014197|OH1004|CDS

ATGGCGGCCTTCTCCTTCCCCAAAACCGCATCAACATCCCTCACCCTCCTCCTCACTTTGATCTTCTTCTTCCTTCTTCAATTCCCCTCATCAAACGATCACCACCGTTTCCAATCTCACCGGAGGTCACTCCTCAACACTACGACCACCACCACTTGTTCACACATTCTTCAAATCCCACAAGATCACCGCTGCTTCTTCTCCACCGACCACTGCTCCGCCCACTCCAATGGCCTTCTCAACTACTTCTCCTTCCACTT...

Protein

Download Protein FASTA

555 aa · LXL04_014197|LXL04_014197|OH1004|PROTEIN

MAAFSFPKTASTSLTLLLTLIFFFLLQFPSSNDHHRFQSHRRSLLNTTTTTTCSHILQIPQDHRCFFSTDHCSAHSNGLLNYFSFHFCHFHQNPFLSVPFLSLTVVLQFYILVKTAQDQFSVVVTKLSTHLNLSPSMGAVTLLALGNGAPDVFASVAAVGGGNARTGFGAILSAGTFVSALVVGFVAIYAAPFSVSPAPFIRDVLFYLTAALFLFYVYLSAEIYLWQAVGFVGFYLFFVGFVFWMDLGIDSGGKLKRGGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_014197
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_014197
LocationChr03:43438287-43440102 (+)
DescriptionSimilar to CCX5: Cation/calcium exchanger 5
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g08960 May act as a membrane-localized, H⁺-dependent K⁺ and Na⁺ transporter.
Characterization of an AtCCX5 gene from Arabidopsis thaliana that involves in high-affinity K⁺ uptake and Na⁺ transport in yeast.2011 · DOI: 10.1016/j.bbrc.2011.09.030
At5g17860 Vacuolar membrane-localized H(+)-dependent K(+) and Na(+) transporter. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_014197 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006812 monoatomic cation transport Biological Process
GO:0006813 potassium ion transport Biological Process
GO:0006814 sodium ion transport Biological Process
GO:0006851 mitochondrial calcium ion transmembrane transport Biological Process
GO:0006874 intracellular calcium ion homeostasis Biological Process
GO:0035725 sodium ion transmembrane transport Biological Process
GO:0042593 glucose homeostasis Biological Process
GO:0051480 regulation of cytosolic calcium ion concentration Biological Process
GO:0051560 mitochondrial calcium ion homeostasis Biological Process
GO:0070588 calcium ion transmembrane transport Biological Process
GO:0071805 potassium ion transmembrane transport Biological Process
GO:0099093 calcium export from the mitochondrion Biological Process
KEGG gene cross-reference
ath:AT1G08960
ath:AT5G17860
hsa:80024
mmu:170756
rno:498185
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.388
Rank 1 · LXL04_014197 · OH-1004
Cell membrane0.353
Rank 2 · LXL04_014197 · OH-1004
Endoplasmic reticulum0.128
Rank 3 · LXL04_014197 · OH-1004
Cytoplasm0.112
Rank 4 · LXL04_014197 · OH-1004
Golgi apparatus0.082
Rank 5 · LXL04_014197 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01699.30Na_Ca_ex103-244 aa
PF01699.30Na_Ca_ex399-548 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_014197PF01699.30Na_Ca_ex1032442.3e-48164.7
LXL04_014197PF01699.30Na_Ca_ex3995482.3e-48164.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O04034Arabidopsis thalianaCation/calcium exchanger 565.074%Swiss-Protstrong database homology
Q9FKP1Arabidopsis thalianaCation/calcium exchanger 130.682%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser