LXL04_014163 | RubberDandelionOmics

Gene overview

LXL04_014163

Reference: OH-1004 Chr: Chr03 Coordinates: 43115390-43115815 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

426 bp · LXL04_014163|LXL04_014163|OH1004|cDNA

ATGCACTCATCCAAAATTTGGGGTATGGAGAAATTAGAAATGATTGACCTTGAAGGAAATTTGATTCACGGGAGCTTACAGTCTCACTTCAGTGGTCTTAAAAACCTCCGAGTTCTCAATTTGGGGTTTAATCAGATTTCCGGAGAGATACCAAATTCAATATCCCAATTCAAGAACCTACAGGTCTTGAATCTCGCAGGCAATCACATCAACGGTTCAATTCCAAGATTTCTCGACAATTTTGGGGATTTACGAGGATT...

CDS

Download CDS FASTA

426 bp · LXL04_014163|LXL04_014163|OH1004|CDS

ATGCACTCATCCAAAATTTGGGGTATGGAGAAATTAGAAATGATTGACCTTGAAGGAAATTTGATTCACGGGAGCTTACAGTCTCACTTCAGTGGTCTTAAAAACCTCCGAGTTCTCAATTTGGGGTTTAATCAGATTTCCGGAGAGATACCAAATTCAATATCCCAATTCAAGAACCTACAGGTCTTGAATCTCGCAGGCAATCACATCAACGGTTCAATTCCAAGATTTCTCGACAATTTTGGGGATTTACGAGGATT...

Protein

Download Protein FASTA

141 aa · LXL04_014163|LXL04_014163|OH1004|PROTEIN

MHSSKIWGMEKLEMIDLEGNLIHGSLQSHFSGLKNLRVLNLGFNQISGEIPNSISQFKNLQVLNLAGNHINGSIPRFLDNFGDLRGLYLSFNQLSRNIPIEIGYKSDFRGQLLQRYDPLSNHHSPKSKTFMGNYIEHMASY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014163`
TK1151 ID	TkA02G449300
OH-1004 ID	LXL04_014163
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014163

Location Chr03:43115390-43115815 (+)

Description Similar to RPK2: LRR receptor-like serine/threonine-protein kinase RPK2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02130`	Key regulator of anther development (e.g. lignification pattern), including tapetum degradation during pollen maturation (e.g. germination capacity).	Receptor-like protein kinase 2 (RPK 2) is a novel factor controlling anther development in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03083.x RPK1 and TOAD2 are two receptor-like kinases redundantly required for arabidopsis embryonic pattern formation.2007 · DOI: 10.1016/j.devcel.2007.04.003 Two receptor-like kinases required together for the establishment of Arabidopsis cotyledon primordia.2008 · DOI: 10.1016/j.ydbio.2007.11.021
`At1g17230`	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230.	No verified direct reference in this release
`At5g45770`	Involved in plant defense.	No verified direct reference in this release
`At5g25910`	Required for defense against powdery mildew pathogen.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014163 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009808 lignin metabolic process Biological Process

GO:0009846 pollen germination Biological Process

GO:0009942 longitudinal axis specification Biological Process

GO:0009945 radial axis specification Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010152 pollen maturation Biological Process

GO:0048508 embryonic meristem development Biological Process

GO:0048653 anther development Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G17230

ath:AT3G02130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.351

Rank 1 · LXL04_014163 · OH-1004

Extracellular0.183

Rank 2 · LXL04_014163 · OH-1004

Endoplasmic reticulum0.151

Rank 3 · LXL04_014163 · OH-1004

Cytoplasm0.134

Rank 4 · LXL04_014163 · OH-1004

Nucleus0.126

Rank 5 · LXL04_014163 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12799.14LRR_411-47 aa

PF13855.13LRR_811-70 aa

PF12799.14LRR_434-74 aa

PF13855.13LRR_854-94 aa

PF12799.14LRR_458-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014163	`PF12799.14`	LRR_4	11	47	6.8e-17	61.8
LXL04_014163	`PF13855.13`	LRR_8	11	70	3e-16	59.6
LXL04_014163	`PF12799.14`	LRR_4	34	74	6.8e-17	61.8
LXL04_014163	`PF13855.13`	LRR_8	54	94	3e-16	59.6
LXL04_014163	`PF12799.14`	LRR_4	58	96	6.8e-17	61.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7I6`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RPK2	56.122%	Swiss-Prot	moderate database homology
`Q9SHI2`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	44.000%	Swiss-Prot	moderate database homology
`Q9FK66`	Arabidopsis thaliana	Receptor-like protein 55	43.182%	Swiss-Prot	moderate database homology
`Q7FZR1`	Arabidopsis thaliana	Receptor-like protein 52	42.574%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card