LXL04_014161 | RubberDandelionOmics

Gene overview

LXL04_014161

Reference: OH-1004 Chr: Chr03 Coordinates: 43087740-43090754 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1548 bp · LXL04_014161|LXL04_014161|OH1004|cDNA

ATGGGGGTGCAGAGAAACCTCGTGAACAGAAAAACCCTCAATCATGTCGCAAATGCTATGCGGTATTCGAATCCAAAGTCCAATATTTCTTCCCTCCGCCGGTTTTCGTCGTTGCAGCCGCCGGAGCTTCCTCCGTTTGATTACCAGCCCGTTCCATACAAAGGTCCATTAGCCGATGAAGTATTCGAAAAACGAAAGAAGTACCTTGGCCCTTCTCTCTTCCATTACTACCAGAAGCCACTTAATATAGTCGAAGGAAA...

CDS

Download CDS FASTA

1548 bp · LXL04_014161|LXL04_014161|OH1004|CDS

ATGGGGGTGCAGAGAAACCTCGTGAACAGAAAAACCCTCAATCATGTCGCAAATGCTATGCGGTATTCGAATCCAAAGTCCAATATTTCTTCCCTCCGCCGGTTTTCGTCGTTGCAGCCGCCGGAGCTTCCTCCGTTTGATTACCAGCCCGTTCCATACAAAGGTCCATTAGCCGATGAAGTATTCGAAAAACGAAAGAAGTACCTTGGCCCTTCTCTCTTCCATTACTACCAGAAGCCACTTAATATAGTCGAAGGAAA...

Protein

Download Protein FASTA

515 aa · LXL04_014161|LXL04_014161|OH1004|PROTEIN

MGVQRNLVNRKTLNHVANAMRYSNPKSNISSLRRFSSLQPPELPPFDYQPVPYKGPLADEVFEKRKKYLGPSLFHYYQKPLNIVEGKMQYLFDESGRRYLDAFAGIVTVSCGHCHPEILRAIEEQNKLLQHATTIYLHHAIGDFAEGLAEKMPGNLKVVYFVNSGTEANELAMLMARLYSGNLGMIALRNAYHGGSAGTIGLTALNTWNKYAEDVQDHIDHGTSGRVAGFISETIQGVGGSVELASGYLKRVYEMVRKAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014161`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014161

Location Chr03:43087740-43090754 (+)

Description Similar to AGT2: Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39660`	Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial.	No verified direct reference in this release
`At3g08860`	Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial.	No verified direct reference in this release
`At2g38400`	Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014161 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009436 glyoxylate catabolic process Biological Process

GO:0009853 photorespiration Biological Process

GO:0019265 glycine biosynthetic process, by transamination of glyoxylate Biological Process

GO:0019481 L-alanine catabolic process, by transamination Biological Process

GO:0043562 cellular response to nitrogen levels Biological Process

GO:0045429 positive regulation of nitric oxide biosynthetic process Biological Process

GO:2001299 N(omega),N(omega)-dimethyl-L-arginine catabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G38400

ath:AT3G08860

ath:AT4G39660

hsa:64902

pon:100171524

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.840

Rank 1 · LXL04_014161 · OH-1004

Cytoplasm0.069

Rank 2 · LXL04_014161 · OH-1004

Peroxisome0.056

Rank 3 · LXL04_014161 · OH-1004

Nucleus0.034

Rank 4 · LXL04_014161 · OH-1004

Plastid0.030

Rank 5 · LXL04_014161 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00202.28Aminotran_380-205 aa

PF00202.28Aminotran_3213-445 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014161	`PF00202.28`	Aminotran_3	80	205	5.9e-80	269.6
LXL04_014161	`PF00202.28`	Aminotran_3	213	445	5.9e-80	269.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940M2`	Arabidopsis thaliana	Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial	75.105%	Swiss-Prot	strong database homology
`Q9SR86`	Arabidopsis thaliana	Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial	60.959%	Swiss-Prot	strong database homology
`Q94AL9`	Arabidopsis thaliana	Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial	56.785%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card