LXL04_014159 | RubberDandelionOmics

Gene overview

LXL04_014159

Reference: OH-1004 Chr: Chr03 Coordinates: 43047237-43049361 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1098 bp · LXL04_014159|LXL04_014159|OH1004|cDNA

atggaagagAAAGAtaaccagaatcaaaacaacagTTCATCATCATCGTTCGTGATCAAGATACCCTCATACGAAGAAGTTATTCAGAGCTCCCAATCGAAAACTCCTCCCCAGTCGCTTTTCAATCCTTCGTCTTTCTCTCAAGCCTTTAACTCCATTAAGAACACCGAGTTCTACgctccacctccacctccacctccttCCTCCTCTTCACTTCCAAGGGGAATTCAGCCATCTGGGGTTGATGCTACTCCGTCTTC...

CDS

Download CDS FASTA

1098 bp · LXL04_014159|LXL04_014159|OH1004|CDS

ATGGAAGAGAAAGATAACCAGAATCAAAACAACAGTTCATCATCATCGTTCGTGATCAAGATACCCTCATACGAAGAAGTTATTCAGAGCTCCCAATCGAAAACTCCTCCCCAGTCGCTTTTCAATCCTTCGTCTTTCTCTCAAGCCTTTAACTCCATTAAGAACACCGAGTTCTACGCTCCACCTCCACCTCCACCTCCTTCCTCCTCTTCACTTCCAAGGGGAATTCAGCCATCTGGGGTTGATGCTACTCCGTCTTC...

Protein

Download Protein FASTA

365 aa · LXL04_014159|LXL04_014159|OH1004|PROTEIN

MEEKDNQNQNNSSSSSFVIKIPSYEEVIQSSQSKTPPQSLFNPSSFSQAFNSIKNTEFYAPPPPPPPSSSSLPRGIQPSGVDATPSSSSPPVSTANSTGASSSSAQNRNNAILVSHRQKGNPLLKHIRNVRWAFADVVCDYMLGQQSCALYLSIRYHLLHPDYLYFRIRELGKNFKLRVVLCHIDVEDVVKPLLEVTRTALLHDCTLLCGWSLEECGRYLETIKVYENKPADIIQGQMDTDYLSRLSHALTSVRHVNKTD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014159`
TK1151 ID	TkA02G449570
OH-1004 ID	LXL04_014159
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014159

Location Chr03:43047237-43049361 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05210`	Seems to be involved in nucleotide excision repair (NER) of damaged DNA (dark repair mechanism).	Arabidopsis mutants sensitive to gamma radiation include the homologue of the human repair gene ERCC1.2003 · DOI: 10.1093/jxb/erg069 Roles of the AtErcc1 protein in recombination.2004 · DOI: 10.1111/j.1365-313x.2004.02136.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014159 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000720 pyrimidine dimer repair by nucleotide-excision repair Biological Process

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006281 DNA repair Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006294 nucleotide-excision repair, preincision complex assembly Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006312 mitotic recombination Biological Process

GO:0006949 syncytium formation Biological Process

GO:0006974 DNA damage response Biological Process

KEGG gene cross-reference

ath:AT3G05210

bta:615637

hsa:2067

mmu:13870

spo:2540887

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.926

Rank 1 · LXL04_014159 · OH-1004

Cytoplasm0.198

Rank 2 · LXL04_014159 · OH-1004

Mitochondrion0.025

Rank 3 · LXL04_014159 · OH-1004

Cell membrane0.021

Rank 4 · LXL04_014159 · OH-1004

Endoplasmic reticulum0.012

Rank 5 · LXL04_014159 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03834.22Rad10110-230 aa

PF14520.13HHH_5249-300 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014159	`PF03834.22`	Rad10	110	230	5.4e-49	165.7
LXL04_014159	`PF14520.13`	HHH_5	249	300	2.6e-07	31.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MA98`	Arabidopsis thaliana	DNA excision repair protein ERCC-1	64.946%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card