LXL04_014110 | RubberDandelionOmics

Gene overview

LXL04_014110

Reference: OH-1004 Chr: Chr03 Coordinates: 42165795-42170325 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1071 bp · LXL04_014110|LXL04_014110|OH1004|cDNA

ATGATATCCCTTGATAAGCTTGTGCTAGATGGTCTATTATTGAAAGAAGAGCTTCCTGAACCACTGGATACACATCGTGTAAATTACGATACTGTTGCTCACATAAAGGATCCTTTGATAGCCAAGGCTGCAAAGAGGCTTATTTCAAGTAAAGGGGATCTCAAAAACCAGCTTGAACATTTCTGCAAAGATCCTGATGTTGCAAGTTGGCTTGAAGATGTAGCATATTTTGCAGCAATTGATGACATTTACAACTCATC...

CDS

Download CDS FASTA

1071 bp · LXL04_014110|LXL04_014110|OH1004|CDS

ATGATATCCCTTGATAAGCTTGTGCTAGATGGTCTATTATTGAAAGAAGAGCTTCCTGAACCACTGGATACACATCGTGTAAATTACGATACTGTTGCTCACATAAAGGATCCTTTGATAGCCAAGGCTGCAAAGAGGCTTATTTCAAGTAAAGGGGATCTCAAAAACCAGCTTGAACATTTCTGCAAAGATCCTGATGTTGCAAGTTGGCTTGAAGATGTAGCATATTTTGCAGCAATTGATGACATTTACAACTCATC...

Protein

Download Protein FASTA

356 aa · LXL04_014110|LXL04_014110|OH1004|PROTEIN

MISLDKLVLDGLLLKEELPEPLDTHRVNYDTVAHIKDPLIAKAAKRLISSKGDLKNQLEHFCKDPDVASWLEDVAYFAAIDDIYNSSYNWYDWHEPLKTRHLSALEDIYHSKKDFIDIFIAQQFLFQRQWKNIRHYANKKGISVMGDMPIYVSYHSADIWANKKYFLLNRKGLKAFSETGQLWTGGTWKFFDAIFRVVGKINIIAEDLGVITEDVVRLRKSIGAPGMAVLQFGKWYRNIVRSAYYVAPEVLRKYGNEIGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014110`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014110

Location Chr03:42165795-42170325 (-)

Description Similar to DPE1: 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64860`	Chloroplastic alpha-glucanotransferase involved in maltotriose metabolism.	A critical role for disproportionating enzyme in starch breakdown is revealed by a knock-out mutation in Arabidopsis.2001 · DOI: 10.1046/j.1365-313x.2001.01012.x Blocking the metabolism of starch breakdown products in Arabidopsis leaves triggers chloroplast degradation.2009 · DOI: 10.1093/mp/ssp093

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0627000`	Chloroplastic alpha-glucanotransferase involved in maltotriose metabolism.	No verified direct reference in this release
`Os07g0515100`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014110 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000025 maltose catabolic process Biological Process

GO:0000272 polysaccharide catabolic process Biological Process

GO:0005983 starch catabolic process Biological Process

GO:0006006 glucose metabolic process Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009501 amyloplast Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004134 4-alpha-glucanotransferase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G64860

dosa:Os07g0515100

dosa:Os07g0627000

osa:4343373

sot:102595076

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.424

Rank 1 · LXL04_014110 · OH-1004

Nucleus0.237

Rank 2 · LXL04_014110 · OH-1004

Extracellular0.137

Rank 3 · LXL04_014110 · OH-1004

Mitochondrion0.097

Rank 4 · LXL04_014110 · OH-1004

Peroxisome0.093

Rank 5 · LXL04_014110 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02446.24Glyco_hydro_772-188 aa

PF02446.24Glyco_hydro_77189-238 aa

PF00069.32Pkinase236-331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014110	`PF02446.24`	Glyco_hydro_77	2	188	8.6e-50	170.7
LXL04_014110	`PF02446.24`	Glyco_hydro_77	189	238	8.6e-50	170.7
LXL04_014110	`PF00069.32`	Pkinase	236	331	5.5e-20	72.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LV91`	Arabidopsis thaliana	4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic	48.173%	Swiss-Prot	moderate database homology
`Q8LI30`	Oryza sativa subsp. japonica	4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic	51.827%	Swiss-Prot	moderate database homology
`P53683`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 19	73.881%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card