LXL04_014095 | RubberDandelionOmics

Gene overview

LXL04_014095

Reference: OH-1004 Chr: Chr03 Coordinates: 42019910-42027174 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4461 bp · LXL04_014095|LXL04_014095|OH1004|cDNA

ATGGTGTTTCTTCGCAACCCGAACTCTGCGCGTTCCAAACGACCTTCCAATTCATTCGTCCCCCCACTCTCTCACCCTTCCAAAATCCCCAAACCCACAGCCGCCTCCACCGCCAATGGTAGCAACACTGTAAATATTCAAAATAAAGACTCTGTAGCACCACCGCCTCAACCAGCATCACTATCCCTAAACTCAATTGACAAAATGGCTTCGATTCTCGCAGACGCCGGTTGTACATTACTTAACACCGCTGGCCCTCC...

CDS

Download CDS FASTA

4461 bp · LXL04_014095|LXL04_014095|OH1004|CDS

ATGGTGTTTCTTCGCAACCCGAACTCTGCGCGTTCCAAACGACCTTCCAATTCATTCGTCCCCCCACTCTCTCACCCTTCCAAAATCCCCAAACCCACAGCCGCCTCCACCGCCAATGGTAGCAACACTGTAAATATTCAAAATAAAGACTCTGTAGCACCACCGCCTCAACCAGCATCACTATCCCTAAACTCAATTGACAAAATGGCTTCGATTCTCGCAGACGCCGGTTGTACATTACTTAACACCGCTGGCCCTCC...

Protein

Download Protein FASTA

1486 aa · LXL04_014095|LXL04_014095|OH1004|PROTEIN

MVFLRNPNSARSKRPSNSFVPPLSHPSKIPKPTAASTANGSNTVNIQNKDSVAPPPQPASLSLNSIDKMASILADAGCTLLNTAGPPCLPADLHKLRHHLQNRLSSDPSLRSQLLEGFSSYIDNQNELRRVLLPSQRYSSSNARGDSLVRVLLLVPSIQLDLQTMLLEKLPEYFDNDNCGHSSSSTMRLDEDIARLILNQFRWLDFLVDSEAFTENLFQVLSICPPHLKREIIGSLPEVMGDSNNKTVVESLERVLQDDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014095`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_014095`
Location	Chr03:42019910-42027174 (+)
Description	Similar to Fancd2: Fanconi anemia group D2 protein homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014095` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006974 DNA damage response Biological Process GO:0007129 homologous chromosome pairing at meiosis Biological Process GO:0007276 gamete generation Biological Process GO:0010332 response to gamma radiation Biological Process GO:0031573 mitotic intra-S DNA damage checkpoint signaling Biological Process GO:0034599 cellular response to oxidative stress Biological Process GO:0036297 interstrand cross-link repair Biological Process GO:0097150 neuronal stem cell population maintenance Biological Process GO:1990918 double-strand break repair involved in meiotic recombination Biological Process GO:2000348 regulation of CD40 signaling pathway Biological Process GO:0000785 chromatin Cellular Component GO:0000793 condensed chromosome Cellular Component
KEGG gene cross-reference	hsa:2177 mmu:211651 rno:312641 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.876

Rank 1 · LXL04_014095 · OH-1004

Cytoplasm0.190

Rank 2 · LXL04_014095 · OH-1004

Cell membrane0.043

Rank 3 · LXL04_014095 · OH-1004

Endoplasmic reticulum0.027

Rank 4 · LXL04_014095 · OH-1004

Golgi apparatus0.024

Rank 5 · LXL04_014095 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14631.12FancD272-935 aa

PF14631.12FancD21188-1457 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014095	`PF14631.12`	FancD2	72	935	1.3e-157	527.4
LXL04_014095	`PF14631.12`	FancD2	1188	1457	1.3e-157	527.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card