LXL04_014073 | RubberDandelionOmics

Gene overview

LXL04_014073

Reference: OH-1004 Chr: Chr03 Coordinates: 41663501-41665848 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2286 bp · LXL04_014073|LXL04_014073|OH1004|cDNA

ATGGCAAGAAATCCTGCAACACGCCTACTCCGGATTTATTCTTCACAATTTAAGGTCAGATTTATCTCATCTTCTAATCGGTTTGCTTTATCTTGCCATGAATTTCATCATCCATCGACGCAAATGCACCAATCGCTTGGTTTCACTCACCCCGAAAGAATCCAGCTCAATAAATGTTCCTCTTCCGGTTTAGATTTTAGGGTTCTTAATCTCAACAAGAGATTTTATTGTACGCCCCGTGAAATTGGAAATTCTTCAGA...

CDS

Download CDS FASTA

2286 bp · LXL04_014073|LXL04_014073|OH1004|CDS

ATGGCAAGAAATCCTGCAACACGCCTACTCCGGATTTATTCTTCACAATTTAAGGTCAGATTTATCTCATCTTCTAATCGGTTTGCTTTATCTTGCCATGAATTTCATCATCCATCGACGCAAATGCACCAATCGCTTGGTTTCACTCACCCCGAAAGAATCCAGCTCAATAAATGTTCCTCTTCCGGTTTAGATTTTAGGGTTCTTAATCTCAACAAGAGATTTTATTGTACGCCCCGTGAAATTGGAAATTCTTCAGA...

Protein

Download Protein FASTA

761 aa · LXL04_014073|LXL04_014073|OH1004|PROTEIN

MARNPATRLLRIYSSQFKVRFISSSNRFALSCHEFHHPSTQMHQSLGFTHPERIQLNKCSSSGLDFRVLNLNKRFYCTPREIGNSSDSIVSEHGDDNKIKSQASASTTESFAHVSALDPVKLYRRLRDGPISEKLGLEECEELSEIFHSFARSGWASNQALAIYISASFFPTAAHQFRNFFFKKINRDTVDYLLSLGPGTQSERFLFPIFVEFSLEHFPDEIKKFRSMISSADLTKPETWFPFARAIKRKIIYHCGPTNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014073`
TK1151 ID	TkA02G456800
OH-1004 ID	LXL04_014073
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014073

Location Chr03:41663501-41665848 (-)

Description Similar to At5g39840: DExH-box ATP-dependent RNA helicase DExH18, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39840`	Major helicase player in mitochondrial RNA metabolism.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0459800`	Major helicase player in mitochondrial RNA metabolism.	No verified direct reference in this release
`UniProt: Q01IJ3`	Major helicase player in mitochondrial RNA metabolism.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014073 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000957 mitochondrial RNA catabolic process Biological Process

GO:0000958 mitochondrial mRNA catabolic process Biological Process

GO:0000962 positive regulation of mitochondrial RNA catabolic process Biological Process

GO:0000965 mitochondrial RNA 3'-end processing Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006401 RNA catabolic process Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010929 positive regulation of auxin mediated signaling pathway Biological Process

GO:0030307 positive regulation of cell growth Biological Process

GO:0035945 mitochondrial ncRNA surveillance Biological Process

KEGG gene cross-reference

ath:AT5G39840

dosa:Os04g0459800

hsa:6832

rno:294385

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.674

Rank 1 · LXL04_014073 · OH-1004

Plastid0.247

Rank 2 · LXL04_014073 · OH-1004

Nucleus0.091

Rank 3 · LXL04_014073 · OH-1004

Cytoplasm0.061

Rank 4 · LXL04_014073 · OH-1004

Peroxisome0.015

Rank 5 · LXL04_014073 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23703.2DExH18_N142-225 aa

PF22527.3DEXQc_Suv3237-390 aa

PF00271.38Helicase_C408-517 aa

PF18147.7Suv3_C_1599-641 aa

PF12513.16SUV3_C663-710 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014073	`PF23703.2`	DExH18_N	142	225	3.2e-37	127.4
LXL04_014073	`PF22527.3`	DEXQc_Suv3	237	390	3.8e-69	231.9
LXL04_014073	`PF00271.38`	Helicase_C	408	517	7.2e-14	52.7
LXL04_014073	`PF18147.7`	Suv3_C_1	599	641	3.5e-19	69.2
LXL04_014073	`PF12513.16`	SUV3_C	663	710	3.8e-11	43.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KFV7`	Arabidopsis thaliana	DExH-box ATP-dependent RNA helicase DExH18, mitochondrial	70.089%	Swiss-Prot	strong database homology
`Q7X745`	Oryza sativa subsp. japonica	ATP-dependent RNA helicase SUV3L, mitochondrial	66.881%	Swiss-Prot	strong database homology
`Q01IJ3`	Oryza sativa subsp. indica	ATP-dependent RNA helicase SUV3L, mitochondrial	66.881%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card