LXL04_014068 | RubberDandelionOmics

Gene overview

LXL04_014068

Reference: OH-1004 Chr: Chr03 Coordinates: 41572546-41573853 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1308 bp · LXL04_014068|LXL04_014068|OH1004|cDNA

ATGGCTGCCACTGTGTCCTCCAACTGTTTCATCgtcttcctcctcctcatcaACTCCGTTTCCTTCTCGATTCAGAACATCCACGCCACAAAATCGCCAGTAAACAActctctctccttctctctCACTTACCTTCCTCTCCCTCACAAATCCGCTGCAACTAAACTTCTACAAAATTCCCTCGCTCAATCATCATCATCGGGTTCCAATCACAGGCTATCGTTCAAATATTCGATGGCTCTGATTGTTTCTCTCCCAAT...

CDS

Download CDS FASTA

1308 bp · LXL04_014068|LXL04_014068|OH1004|CDS

ATGGCTGCCACTGTGTCCTCCAACTGTTTCATCGTCTTCCTCCTCCTCATCAACTCCGTTTCCTTCTCGATTCAGAACATCCACGCCACAAAATCGCCAGTAAACAACTCTCTCTCCTTCTCTCTCACTTACCTTCCTCTCCCTCACAAATCCGCTGCAACTAAACTTCTACAAAATTCCCTCGCTCAATCATCATCATCGGGTTCCAATCACAGGCTATCGTTCAAATATTCGATGGCTCTGATTGTTTCTCTCCCAAT...

Protein

Download Protein FASTA

435 aa · LXL04_014068|LXL04_014068|OH1004|PROTEIN

MAATVSSNCFIVFLLLINSVSFSIQNIHATKSPVNNSLSFSLTYLPLPHKSAATKLLQNSLAQSSSSGSNHRLSFKYSMALIVSLPIGTPPQAQQMVLDTGSQLSWIQCHNKTPRTSFDPSLSSSFSILPCNHPICKPRVPDFTLPTTCDQNRLCHYSYFYADGTLAEGNLVREKITFSRYQSTPPITLGCAAASAEAEGILGMNLGRLSFASQAKISKFSYCTPARQNNAKIKPTGAFYLGQNPYSKTFKYVDILTFPK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014068`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014068

Location Chr03:41572546-41573853 (-)

Description Similar to PCS1: Aspartic proteinase PCS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02190`	Embryo-specific aspartic protease that limits programmed cell death during reproductive development.	No verified direct reference in this release
`At3g12700`	Aspartic proteinase that can use azocasein as substrate and regulates endogenous sugar levels (e.g. sucrose, glucose and fructose) by modulating starch accumulation and remobilization.	Misexpression of a chloroplast aspartyl protease leads to severe growth defects and alters carbohydrate metabolism in Arabidopsis.2012 · DOI: 10.1104/pp.112.204016

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0186900`	Anther-specific aspartic protease involved in tapetal programmed cell death (PCD).	EAT1 promotes tapetal cell death by regulating aspartic proteases during male reproductive development in rice.2013 · DOI: 10.1038/ncomms2396

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014068 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006508 proteolysis Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009744 response to sucrose Biological Process

GO:0010019 chloroplast-nucleus signaling pathway Biological Process

GO:0012501 programmed cell death Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G12700

ath:AT5G02190

dosa:Os03g0186900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.548

Rank 1 · LXL04_014068 · OH-1004

Cell membrane0.142

Rank 2 · LXL04_014068 · OH-1004

Endoplasmic reticulum0.126

Rank 3 · LXL04_014068 · OH-1004

Cytoplasm0.065

Rank 4 · LXL04_014068 · OH-1004

Lysosome / Vacuole0.039

Rank 5 · LXL04_014068 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543.12TAXi_N82-229 aa

PF00026.29Asp85-427 aa

PF14541.12TAXi_C271-426 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014068	`PF14543.12`	TAXi_N	82	229	2.1e-32	113.4
LXL04_014068	`PF00026.29`	Asp	85	427	5.3e-13	49.8
LXL04_014068	`PF14541.12`	TAXi_C	271	426	4.2e-34	118.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZL3`	Arabidopsis thaliana	Aspartic proteinase PCS1	33.929%	Swiss-Prot	moderate database homology
`Q9LTW4`	Arabidopsis thaliana	Aspartic proteinase NANA, chloroplast	30.518%	Swiss-Prot	moderate database homology
`Q6F4N5`	Oryza sativa subsp. japonica	Aspartyl protease 25	26.316%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card