Gene Card
Gene overview
cDNA / CDS / Protein Sequences
636 bp · LXL04_014041|LXL04_014041|OH1004|cDNA
CATGAAGCGAGAAATTCTTCGCATAAATCGTCTCCAAAAGGTCTCAACCATGCACACACTTTGTTACTGTGCTTCTTCGAAGCTGACATATCCTTTCTCTCATCTCTGCACCATCATCTCCTCCACTCCATTCCAATGGCCGCCGCAAAGCAAAACCAATCCCCAACACTACCACCATATACAGAGATGATTTTCGCAGCAATTGATTCACTGAAAGGCAAGGAAGGTTCAAGTGAATCGGCGATTTCAGACTACATCGA...
576 bp · LXL04_014041|LXL04_014041|OH1004|CDS
TTGTTACTGTGCTTCTTCGAAGCTGACATATCCTTTCTCTCATCTCTGCACCATCATCTCCTCCACTCCATTCCAATGGCCGCCGCAAAGCAAAACCAATCCCCAACACTACCACCATATACAGAGATGATTTTCGCAGCAATTGATTCACTGAAAGGCAAGGAAGGTTCAAGTGAATCGGCGATTTCAGACTACATCGAATCCACCTGTGGCTCTTTGCCAGAAGAACACATCAATATTCTGACTGACAACTTGAACAA...
Protein
Download Protein FASTA191 aa · LXL04_014041|LXL04_014041|OH1004|PROTEIN
MLLCFFEADISFLSSLHHHLLHSIPMAAAKQNQSPTLPPYTEMIFAAIDSLKGKEGSSESAISDYIESTCGSLPEEHINILTDNLNKLVESGELVVVNDSNYMRPDPTETPKRGRGRPPKPKDTTVTETQTQAQSGSEVKRGRGRPKKDPNAAPSAKKVKVGPVSSPSSTTGRPRGRPRKVQPELASVEAN
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014041 |
|---|---|
| TK1151 ID | TkA02G454070 |
| OH-1004 ID | LXL04_014041 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 90.521 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014041 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:41040190-41041022 (+) | |||||||||
| Description | Similar to HMGIY2: HMG-Y-related protein A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006334 nucleosome assembly Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0030261 chromosome condensation Biological Process GO:0045910 negative regulation of DNA recombination Biological Process GO:2000014 regulation of endosperm development Biological Process GO:0000786 nucleosome Cellular Component GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0009507 chloroplast Cellular Component GO:0003677 DNA binding Molecular Function GO:0003690 double-stranded DNA binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G14900 ath:AT2G30620 gmx:548080 zma:541871 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00538.26Linker_histone38-97 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_014041 | PF00538.26 | Linker_histone | 38 | 97 | 9e-11 | 42.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.