LXL04_014009 | RubberDandelionOmics

Gene overview

LXL04_014009

Reference: OH-1004 Chr: Chr03 Coordinates: 40468762-40471148 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2313 bp · LXL04_014009|LXL04_014009|OH1004|cDNA

ATGTTACAACAAAAAGCAACAGGCAAAGGGCATTCGTGGTGGTGGGCTAGTCATATTCGAACTAAGCAGTCCAGATGGCTCGAACAAAATCTCCAAGATATGGACGTCAAGGTGGATCATGTTCTCAATTTGATTCAAAACGATGGCGATTCGTTTGCCAGAAGGGCGGAGATGTATTATAAACACCGGCCGGATGTTATCAACTTCGTCGAGGAAACTCTTCGTGCTTATCGATCGTTAGCGGAGAGGTATGATAAATT...

CDS

Download CDS FASTA

2313 bp · LXL04_014009|LXL04_014009|OH1004|CDS

ATGTTACAACAAAAAGCAACAGGCAAAGGGCATTCGTGGTGGTGGGCTAGTCATATTCGAACTAAGCAGTCCAGATGGCTCGAACAAAATCTCCAAGATATGGACGTCAAGGTGGATCATGTTCTCAATTTGATTCAAAACGATGGCGATTCGTTTGCCAGAAGGGCGGAGATGTATTATAAACACCGGCCGGATGTTATCAACTTCGTCGAGGAAACTCTTCGTGCTTATCGATCGTTAGCGGAGAGGTATGATAAATT...

Protein

Download Protein FASTA

770 aa · LXL04_014009|LXL04_014009|OH1004|PROTEIN

MLQQKATGKGHSWWWASHIRTKQSRWLEQNLQDMDVKVDHVLNLIQNDGDSFARRAEMYYKHRPDVINFVEETLRAYRSLAERYDKLSNALQKANTTIASVCPEKVDYNLDDDDDFNDVSSKLTKNSDSTKAPKLVRQKRTKIPKTPKPVNKDVNQVLNNASKTIQATKTKEEKENQNHSNDGLTKVDALEEIDNLQKQIEEMQAMKDSMKNYYENSLAEYWDAETQIIESRQRICSLEDEFEICKTIEEDEAGTSMAEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014009`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014009

Location Chr03:40468762-40471148 (+)

Description Similar to NET2A: Protein NETWORKED 2A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g58215`	Plant-specific actin binding protein.	No verified direct reference in this release
`At2g22560`	Plant-specific actin binding protein.	No verified direct reference in this release
`At1g09720`	Plant-specific actin binding protein.	No verified direct reference in this release
`At5g10500`	Plant-specific actin binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014009 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0003779 actin binding Molecular Function

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT1G58215

ath:AT2G22560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.540

Rank 1 · LXL04_014009 · OH-1004

Nucleus0.266

Rank 2 · LXL04_014009 · OH-1004

Cell membrane0.162

Rank 3 · LXL04_014009 · OH-1004

Golgi apparatus0.083

Rank 4 · LXL04_014009 · OH-1004

Mitochondrion0.077

Rank 5 · LXL04_014009 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07765.18KIP112-85 aa

PF25014.2NET2A238-326 aa

PF25014.2NET2A331-421 aa

PF24918.2NET2A_C564-717 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014009	`PF07765.18`	KIP1	12	85	4.7e-34	117.1
LXL04_014009	`PF25014.2`	NET2A	238	326	2.3e-32	113.5
LXL04_014009	`PF25014.2`	NET2A	331	421	2.3e-32	113.5
LXL04_014009	`PF24918.2`	NET2A_C	564	717	2.4e-40	139.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DMS1`	Arabidopsis thaliana	Protein NETWORKED 2A	35.025%	Swiss-Prot	moderate database homology
`F4IJK1`	Arabidopsis thaliana	Protein NETWORKED 2D	41.096%	Swiss-Prot	moderate database homology
`F4I131`	Arabidopsis thaliana	Protein NETWORKED 2B	34.512%	Swiss-Prot	moderate database homology
`Q8LPQ1`	Arabidopsis thaliana	Protein NETWORKED 2C	36.825%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card