LXL04_013940 | RubberDandelionOmics

Gene overview

LXL04_013940

Reference: OH-1004 Chr: Chr03 Coordinates: 38645683-38647332 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1650 bp · LXL04_013940|LXL04_013940|OH1004|cDNA

ATGGATCAGTTCCGGCCAAGTCCAGCCAACTCATCGGCGCTTACTCCTCTTAGTTTTCTTGATCGGTGCGCCACCGTCTATGGGGACTGCCCCTCTGTCGTCTACGGTGACACCACCTATACTTGGAACGAGACCCGACGAAGGGTTATTCAGGTGGCGTCCTCCATTTCCAAGCTCGGAATTAAGAGAAACCAGGTTGTTTCCGTCGTTGCCCCAAATGTACCTGCCATGTATGAGCTCTACTTTGCCATACCCATGGC...

CDS

Download CDS FASTA

1650 bp · LXL04_013940|LXL04_013940|OH1004|CDS

ATGGATCAGTTCCGGCCAAGTCCAGCCAACTCATCGGCGCTTACTCCTCTTAGTTTTCTTGATCGGTGCGCCACCGTCTATGGGGACTGCCCCTCTGTCGTCTACGGTGACACCACCTATACTTGGAACGAGACCCGACGAAGGGTTATTCAGGTGGCGTCCTCCATTTCCAAGCTCGGAATTAAGAGAAACCAGGTTGTTTCCGTCGTTGCCCCAAATGTACCTGCCATGTATGAGCTCTACTTTGCCATACCCATGGC...

Protein

Download Protein FASTA

549 aa · LXL04_013940|LXL04_013940|OH1004|PROTEIN

MDQFRPSPANSSALTPLSFLDRCATVYGDCPSVVYGDTTYTWNETRRRVIQVASSISKLGIKRNQVVSVVAPNVPAMYELYFAIPMAGGIINSINTRLDARTVSVILSHSESKLVFVDYQSISIVLDAISLFSPNTQKPMLVLITDDEPQRQSMVGFRCTYESMVETGDPGFNWIRPVSECDPMTLNYTSGTTSSPKGVVHCHRGMFLIAVDSLLDWSVPKQPVYLWTLPMFHANGWGYTWGTAAVGATNICLRKFDAAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013940`
TK1151 ID	TkA02G462120
OH-1004 ID	LXL04_013940
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	65.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013940

Location Chr03:38645683-38647332 (-)

Description Similar to AAE5: Probable acyl-activating enzyme 5, peroxisomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16370`	May act as an acid--thiol ligase that activates carboxylic acids by forming acyl-CoAs.	No verified direct reference in this release
`At5g16340`	May act as an acid--thiol ligase that activates carboxylic acids by forming acyl-CoAs.	No verified direct reference in this release
`At1g21540`	May act as an acid--thiol ligase that activates carboxylic acids by forming acyl-CoAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013940 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0009083 branched-chain amino acid catabolic process Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003987 acetate-CoA ligase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016405 CoA-ligase activity Molecular Function

GO:0016874 ligase activity Molecular Function

GO:0031956 medium-chain fatty acid-CoA ligase activity Molecular Function

GO:0043759 2-methylbutanoate-CoA ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G21540

ath:AT5G16340

ath:AT5G16370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.731

Rank 1 · LXL04_013940 · OH-1004

Mitochondrion0.141

Rank 2 · LXL04_013940 · OH-1004

Cytoplasm0.136

Rank 3 · LXL04_013940 · OH-1004

Nucleus0.047

Rank 4 · LXL04_013940 · OH-1004

Endoplasmic reticulum0.044

Rank 5 · LXL04_013940 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00501.35AMP-binding21-400 aa

PF13193.13AMP-binding_C451-528 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013940	`PF00501.35`	AMP-binding	21	400	2.5e-72	244.5
LXL04_013940	`PF13193.13`	AMP-binding_C	451	528	1.7e-24	87.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFE6`	Arabidopsis thaliana	Probable acyl-activating enzyme 5, peroxisomal	67.027%	Swiss-Prot	strong database homology
`Q9FFE9`	Arabidopsis thaliana	Probable acyl-activating enzyme 6	66.788%	Swiss-Prot	strong database homology
`Q9LPK6`	Arabidopsis thaliana	Probable acyl-activating enzyme 9	64.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card