LXL04_013925 | RubberDandelionOmics

Gene overview

LXL04_013925

Reference: OH-1004 Chr: Chr03 Coordinates: 38163930-38166482 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1185 bp · LXL04_013925|LXL04_013925|OH1004|cDNA

ATGGGGTTTGTAGATCTGTTTTCTGCTGCTTCTATGCCAATTCTCAAAGTTCTGATAGTTACTGCACTTGGCTCTGTTCTTGCCCTGGATTCTATTGATCTCTTGGGACAAACTACGAGGAAGCAAGTCAATAATATTGTGTTCTTTGTGTTCAGTCCAGCACTTGTGGGCAGCAATCTGGCTAGTACTATCACACTTGAAAGCATCATTTCCATGTGGTTTATGCCTGTTAATATTCTGATAACATTCATAATTGGGTC...

CDS

Download CDS FASTA

1185 bp · LXL04_013925|LXL04_013925|OH1004|CDS

ATGGGGTTTGTAGATCTGTTTTCTGCTGCTTCTATGCCAATTCTCAAAGTTCTGATAGTTACTGCACTTGGCTCTGTTCTTGCCCTGGATTCTATTGATCTCTTGGGACAAACTACGAGGAAGCAAGTCAATAATATTGTGTTCTTTGTGTTCAGTCCAGCACTTGTGGGCAGCAATCTGGCTAGTACTATCACACTTGAAAGCATCATTTCCATGTGGTTTATGCCTGTTAATATTCTGATAACATTCATAATTGGGTC...

Protein

Download Protein FASTA

394 aa · LXL04_013925|LXL04_013925|OH1004|PROTEIN

MGFVDLFSAASMPILKVLIVTALGSVLALDSIDLLGQTTRKQVNNIVFFVFSPALVGSNLASTITLESIISMWFMPVNILITFIIGSALGWVLLIIARPPQHLKGLILGACAAGNMGNLPLIIIPAVCKEKGSPFGDPDVCHEYAMAYASLSLAIGAIYLWTYVYNLVRVFSGQPQDSGNNVVKETQTMQDDLTESLLPSSSSTLNQKVKVMLNTMKQHLLYFSRMINLKTLFAPSTNGAIVGFVVGTIAPMRKLLIGTT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013925`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013925

Location Chr03:38163930-38166482 (+)

Description Similar to PILS3: Protein PIN-LIKES 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76520`	Involved in cellular auxin homeostasis by regulating auxin metabolism.	No verified direct reference in this release
`At1g20925`	Involved in cellular auxin homeostasis by regulating auxin metabolism.	No verified direct reference in this release
`At1g76530`	Involved in cellular auxin homeostasis by regulating auxin metabolism.	No verified direct reference in this release
`At2g17500`	Involved in cellular auxin homeostasis by regulating auxin metabolism.	No verified direct reference in this release
`At5g65980`	Involved in cellular auxin homeostasis by regulating auxin metabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013925 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0010311 lateral root formation Biological Process

GO:0040009 regulation of growth rate Biological Process

GO:0080162 endoplasmic reticulum to cytosol auxin transport Biological Process

GO:0140964 intracellular auxin homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G20925

ath:AT1G76520

ath:AT1G76530

ath:AT2G17500

ath:AT5G65980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.307

Rank 1 · LXL04_013925 · OH-1004

Cell membrane0.272

Rank 2 · LXL04_013925 · OH-1004

Lysosome / Vacuole0.208

Rank 3 · LXL04_013925 · OH-1004

Golgi apparatus0.102

Rank 4 · LXL04_013925 · OH-1004

Cytoplasm0.074

Rank 5 · LXL04_013925 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03547.24Mem_trans10-385 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013925	`PF03547.24`	Mem_trans	10	385	1.7e-68	231.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9K5`	Arabidopsis thaliana	Protein PIN-LIKES 3	56.633%	Swiss-Prot	strong database homology
`F4HWB6`	Arabidopsis thaliana	Protein PIN-LIKES 1	55.190%	Swiss-Prot	strong database homology
`Q9C9K4`	Arabidopsis thaliana	Protein PIN-LIKES 4	48.694%	Swiss-Prot	moderate database homology
`Q9SHL8`	Arabidopsis thaliana	Protein PIN-LIKES 5	44.836%	Swiss-Prot	moderate database homology
`Q9FKY4`	Arabidopsis thaliana	Protein PIN-LIKES 7	47.342%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card