LXL04_013915 | RubberDandelionOmics

Gene overview

LXL04_013915

Reference: OH-1004 Chr: Chr03 Coordinates: 37872179-37872769 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · LXL04_013915|LXL04_013915|OH1004|cDNA

ATGACTCGACTGTACAGATTCCTTTCCGCCGTCGATAAGCCGATGACAATAGCGGACCCGCCTGAGGCAGTAGCTGCGGAATCCGATTTCGTTGTCATCCTCGCCGCTCTCCTTTGTGCTCTAATCTGTGTTGCAGGTCTCATCGCAGTAGCTCGCTGCGCATGGCTCCGTCGCGGATTCGTCGATAGCGGCAACCGGATTCCCGTCCAGCGCGCTGCAAACAGAGGATTAAAAAAGAAGACGATTCAAACGTTTCCGAC...

CDS

Download CDS FASTA

591 bp · LXL04_013915|LXL04_013915|OH1004|CDS

ATGACTCGACTGTACAGATTCCTTTCCGCCGTCGATAAGCCGATGACAATAGCGGACCCGCCTGAGGCAGTAGCTGCGGAATCCGATTTCGTTGTCATCCTCGCCGCTCTCCTTTGTGCTCTAATCTGTGTTGCAGGTCTCATCGCAGTAGCTCGCTGCGCATGGCTCCGTCGCGGATTCGTCGATAGCGGCAACCGGATTCCCGTCCAGCGCGCTGCAAACAGAGGATTAAAAAAGAAGACGATTCAAACGTTTCCGAC...

Protein

Download Protein FASTA

196 aa · LXL04_013915|LXL04_013915|OH1004|PROTEIN

MTRLYRFLSAVDKPMTIADPPEAVAAESDFVVILAALLCALICVAGLIAVARCAWLRRGFVDSGNRIPVQRAANRGLKKKTIQTFPTFTYDSDKEDKGCGSCAKLSSSDCAICLAEYVDGDEIRVLPQCGHGFHVGCIDTWLNSHSSCPSCRQNLVTTRCKKCGELPPVSDGKIVPEAEDKSRKHSSCSSSSDDLP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013915`
TK1151 ID	TkA02G465030
OH-1004 ID	LXL04_013915
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.500
Protein coverage (%)	TK1151 100.000 / OH-1004 92.857 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013915

Location Chr03:37872179-37872769 (+)

Description Similar to ATL80: RING-H2 finger protein ATL80

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20823`	May be involved in the early steps of the plant defense signaling pathway.	No verified direct reference in this release
`At1g76410`	RING-H2 finger protein ATL8.	No verified direct reference in this release
`At2g17450`	E3 ubiquitin-protein ligase that possess E3 ubiquitin ligase activity in vitro and mediates protein monoubiquitination.	Ligand-induced monoubiquitination of BIK1 regulates plant immunity.2020 · DOI: 10.1038/s41586-020-2210-3
`At4g35480`	E3 ubiquitin-protein ligase that possess E3 ubiquitin ligase activity in vitro and mediates protein monoubiquitination.	Ligand-induced monoubiquitination of BIK1 regulates plant immunity.2020 · DOI: 10.1038/s41586-020-2210-3
`At5g05280`	RING-H2 finger protein ATL73.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013915 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006513 protein monoubiquitination Biological Process

GO:0006952 defense response Biological Process

GO:0009555 pollen development Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010966 regulation of phosphate transport Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0048443 stamen development Biological Process

GO:0051865 protein autoubiquitination Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0080141 regulation of jasmonic acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G20823

ath:AT1G76410

ath:AT2G17450

ath:AT4G35480

ath:AT5G05280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.440

Rank 1 · LXL04_013915 · OH-1004

Endoplasmic reticulum0.249

Rank 2 · LXL04_013915 · OH-1004

Lysosome / Vacuole0.184

Rank 3 · LXL04_013915 · OH-1004

Cytoplasm0.149

Rank 4 · LXL04_013915 · OH-1004

Nucleus0.135

Rank 5 · LXL04_013915 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12861.14zf-ANAPC1197-157 aa

PF12678.14zf-rbx199-152 aa

PF13639.13zf-RING_2109-152 aa

PF17123.12zf-RING_11109-138 aa

PF14634.13zf-RING_5109-153 aa

PF13923.13zf-C3HC4_2110-151 aa

PF00097.32zf-C3HC4110-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013915	`PF12861.14`	zf-ANAPC11	97	157	7.1e-07	29.9
LXL04_013915	`PF12678.14`	zf-rbx1	99	152	2e-09	38.2
LXL04_013915	`PF13639.13`	zf-RING_2	109	152	4.4e-15	56.4
LXL04_013915	`PF17123.12`	zf-RING_11	109	138	1.7e-11	44.3
LXL04_013915	`PF14634.13`	zf-RING_5	109	153	1e-05	26.1
LXL04_013915	`PF13923.13`	zf-C3HC4_2	110	151	3e-09	37.3
LXL04_013915	`PF00097.32`	zf-C3HC4	110	151	3.7e-08	33.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LM69`	Arabidopsis thaliana	RING-H2 finger protein ATL80	54.706%	Swiss-Prot	strong database homology
`Q8LC69`	Arabidopsis thaliana	RING-H2 finger protein ATL8	51.256%	Swiss-Prot	strong database homology
`O22755`	Arabidopsis thaliana	Probable E3 ubiquitin-protein ligase ATL44	53.049%	Swiss-Prot	strong database homology
`Q9ZT49`	Arabidopsis thaliana	Probable E3 ubiquitin-protein ligase ATL45	49.419%	Swiss-Prot	moderate database homology
`Q9FLC6`	Arabidopsis thaliana	RING-H2 finger protein ATL73	42.949%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card