Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2430 bp · LXL04_013903|LXL04_013903|OH1004|cDNA
ATGGATCAATTCGAGTTGTACTTCAAGCGAGCAGATACGGATCAAGACGGCCGTATTAGTGGCACCGAAGCTGTTTCCTTCTTTCATGCCTCCGGTTTACCTACGCCAGTTCTCGCCCAGATATGGACACATGCCGATCAAAATCGAACCGGTTACCTAGGACGACCAGAGTTTTACAATGCTCTCAAACTTGTAACAGTTGCACAAAGTAAGATGGATCTTACTTCAGATATAGTGAAGGCAGCATTATACGGACCTGC...
2430 bp · LXL04_013903|LXL04_013903|OH1004|CDS
ATGGATCAATTCGAGTTGTACTTCAAGCGAGCAGATACGGATCAAGACGGCCGTATTAGTGGCACCGAAGCTGTTTCCTTCTTTCATGCCTCCGGTTTACCTACGCCAGTTCTCGCCCAGATATGGACACATGCCGATCAAAATCGAACCGGTTACCTAGGACGACCAGAGTTTTACAATGCTCTCAAACTTGTAACAGTTGCACAAAGTAAGATGGATCTTACTTCAGATATAGTGAAGGCAGCATTATACGGACCTGC...
Protein
Download Protein FASTA809 aa · LXL04_013903|LXL04_013903|OH1004|PROTEIN
MDQFELYFKRADTDQDGRISGTEAVSFFHASGLPTPVLAQIWTHADQNRTGYLGRPEFYNALKLVTVAQSKMDLTSDIVKAALYGPASAKIPAPKINLTALSTPHSNLNPGPPSLQIPASLPTASHTTTIRQPHLTPLPNQQLQPNNQRIPVTGENIPSSQSWPKMTQTNIQKYTKVFVKVDTDRDGKITDEQAHTLFLSWELPRGRWDPHCIVFFEGVNILKQVWDLSDQDNDSMLSLTEFCIALFLMERHREGHPLPK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_013903 |
|---|---|
| TK1151 ID | TkA02G465570 |
| OH-1004 ID | LXL04_013903 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 97.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 47.466Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_013903 |
|---|---|
| Location | Chr03:37727127-37730461 (+) |
| Description | Similar to itsn1: Intersectin-1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006887 exocytosis Biological Process GO:0006897 endocytosis Biological Process GO:0007264 small GTPase-mediated signal transduction Biological Process GO:0007267 cell-cell signaling Biological Process GO:0008104 intracellular protein localization Biological Process GO:0015031 protein transport Biological Process GO:0016197 endosomal transport Biological Process GO:0035025 positive regulation of Rho protein signal transduction Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0051056 regulation of small GTPase mediated signal transduction Biological Process GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction Biological Process GO:0060124 positive regulation of growth hormone secretion Biological Process |
| KEGG gene cross-reference | ddi:DDB_G0287325 hsa:6453 mmu:16443 rno:29491 xla:394300 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12763.14EH5-70 aaPF13499.13EF-hand_77-62 aaPF12763.14EH167-252 aaPF13499.13EF-hand_7176-245 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_013903 | PF12763.14 | EH | 5 | 70 | 5.7e-21 | 75.1 |
| LXL04_013903 | PF13499.13 | EF-hand_7 | 7 | 62 | 2e-12 | 48.0 |
| LXL04_013903 | PF12763.14 | EH | 167 | 252 | 5.7e-21 | 75.1 |
| LXL04_013903 | PF13499.13 | EF-hand_7 | 176 | 245 | 2e-12 | 48.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.