LXL04_013857 | RubberDandelionOmics

Gene overview

LXL04_013857

Reference: OH-1004 Chr: Chr03 Coordinates: 37031387-37033071 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

819 bp · LXL04_013857|LXL04_013857|OH1004|cDNA

ATGGCCAAGGCCCAAGAGAGGAGAGAAGAGTGGGAGCCTGGGAGGAAGGGGAGCATCTGCGTGACCTCTTttgtctgcgccgcgcagaccACACGCAGACATAAGAGTTTGCAGATCTCCTCTCCTCCATCGCGATTCAACAGCCGCTGCACCAAGCTCATCGCCGTCTTCAGCACAGATCGTCGCGTCTTCAGTCGCGATCTTCTCCTCTCCTCCATCGCTGATCGACCGGCGCTCCTCTCCTCCGTACAAACCGTCGA...

CDS

Download CDS FASTA

819 bp · LXL04_013857|LXL04_013857|OH1004|CDS

ATGGCCAAGGCCCAAGAGAGGAGAGAAGAGTGGGAGCCTGGGAGGAAGGGGAGCATCTGCGTGACCTCTTTTGTCTGCGCCGCGCAGACCACACGCAGACATAAGAGTTTGCAGATCTCCTCTCCTCCATCGCGATTCAACAGCCGCTGCACCAAGCTCATCGCCGTCTTCAGCACAGATCGTCGCGTCTTCAGTCGCGATCTTCTCCTCTCCTCCATCGCTGATCGACCGGCGCTCCTCTCCTCCGTACAAACCGTCGA...

Protein

Download Protein FASTA

272 aa · LXL04_013857|LXL04_013857|OH1004|PROTEIN

MAKAQERREEWEPGRKGSICVTSFVCAAQTTRRHKSLQISSPPSRFNSRCTKLIAVFSTDRRVFSRDLLLSSIADRPALLSSVQTVDFKPQRSISVAIFSRFQSISADFNPISPDFFTTNTEFLHYMYADFTPISSPDFTRIFKAEVLNQKSNFSILFGKLSILYVVFWLLAMGEKHQWSNDQIKCLLETCIEEVNTIGRKGLSLHKDSWNKVGRVLKDNFGVDLTKKQLKNSYDNLKAKYTGWIYLKNKTGNLYNPQTN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013857`
TK1151 ID	TkA02G467500
OH-1004 ID	LXL04_013857
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.800
Protein coverage (%)	TK1151 72.650 / OH-1004 31.250 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013857

Location Chr03:37031387-37033071 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05800`	Transcriptional repressor that associates with ribosomal protein promoters.	NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism.2015 · DOI: 10.1038/nature14171

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013857 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific Molecular Function

KEGG gene cross-reference

ath:AT5G05800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.651

Rank 1 · LXL04_013857 · OH-1004

Cytoplasm0.299

Rank 2 · LXL04_013857 · OH-1004

Endoplasmic reticulum0.060

Rank 3 · LXL04_013857 · OH-1004

Cell membrane0.055

Rank 4 · LXL04_013857 · OH-1004

Plastid0.034

Rank 5 · LXL04_013857 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12776.14Myb_DNA-bind_3178-272 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013857	`PF12776.14`	Myb_DNA-bind_3	178	272	1.3e-13	52.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFJ8`	Arabidopsis thaliana	L10-interacting MYB domain-containing protein	26.596%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card