Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1053 bp · LXL04_013818|LXL04_013818|OH1004|cDNA
ATGGGTTGTATGATCGTCTTTGGATTGTTTGTAGGTGGACCAGATGGAGAAGACAAGGTATCATTGGAGCTCACTGAAGAAATCATTCAGAGCATGGAAGTAGGCATGGCATTCCGTGATTATAATGGTAGAATAAGTTCAATGGATTTTCACAGGACATCAAATTACTTGGTGACTGCTAGTGATGATGAATCCATTCGCCTCTATGATGTGTCTAATGCAACATGTTTAAAGACAATTAACAGCAAAAAGTATGGAGT...
1053 bp · LXL04_013818|LXL04_013818|OH1004|CDS
ATGGGTTGTATGATCGTCTTTGGATTGTTTGTAGGTGGACCAGATGGAGAAGACAAGGTATCATTGGAGCTCACTGAAGAAATCATTCAGAGCATGGAAGTAGGCATGGCATTCCGTGATTATAATGGTAGAATAAGTTCAATGGATTTTCACAGGACATCAAATTACTTGGTGACTGCTAGTGATGATGAATCCATTCGCCTCTATGATGTGTCTAATGCAACATGTTTAAAGACAATTAACAGCAAAAAGTATGGAGT...
Protein
Download Protein FASTA350 aa · LXL04_013818|LXL04_013818|OH1004|PROTEIN
MGCMIVFGLFVGGPDGEDKVSLELTEEIIQSMEVGMAFRDYNGRISSMDFHRTSNYLVTASDDESIRLYDVSNATCLKTINSKKYGVDLVSFTSHPTTVIYSSKNGWDESLRLLSLHDNKYLRYFKGHHDRHGLCLLVYVLEQIVSFPALLIELFFFGIKELINVRLASCICLYGLLRVKGRPATAYDDQGLVFAVAFGGSIRMFDSRNYEKGPYEIFSVGGDVSDANVVKFSNDGKLMLLTTKDSRVHVLDSFRGTLLG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_013818 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_013818 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr03:36430946-36434123 (-) | ||||||
| Description | Similar to APRF1: Protein ANTHESIS POMOTING FACTOR 1 | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0001111 RNA polymerase II promoter clearance Biological Process GO:0006353 DNA-templated transcription termination Biological Process GO:0009908 flower development Biological Process GO:0010467 gene expression Biological Process GO:0032785 negative regulation of DNA-templated transcription, elongation Biological Process GO:0032968 positive regulation of transcription elongation by RNA polymerase II Biological Process GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process GO:0048586 regulation of long-day photoperiodism, flowering Biological Process GO:0071027 nuclear RNA surveillance Biological Process GO:0110064 lncRNA catabolic process Biological Process GO:0140744 negative regulation of lncRNA transcription Biological Process GO:0000781 chromosome, telomeric region Cellular Component | ||||||
| KEGG gene cross-reference | ath:AT5G14530 mmu:77305 xla:494657 xla:735072 xtr:448141 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF25047.1Beta-prop_TEP1_2nd27-146 aaPF24814.2WD40_Prp1933-130 aaPF23381.2Beta-prop_IFT122_1st34-130 aaPF25174.2Beta-prop_THOC336-116 aaPF23414.2Beta-prop_EML_236-100 aaPF25168.2Beta-prop_WDR36-Utp21_2nd36-82 aaPF24817.2WD40_WDHD1_1st37-90 aaPF25173.2Beta-prop_WDR3_1st38-105 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_013818 | PF25047.1 | Beta-prop_TEP1_2nd | 27 | 146 | 5.8e-10 | 39.5 |
| LXL04_013818 | PF24814.2 | WD40_Prp19 | 33 | 130 | 6.6e-19 | 68.8 |
| LXL04_013818 | PF23381.2 | Beta-prop_IFT122_1st | 34 | 130 | 1.3e-17 | 64.7 |
| LXL04_013818 | PF25174.2 | Beta-prop_THOC3 | 36 | 116 | 4.6e-22 | 79.0 |
| LXL04_013818 | PF23414.2 | Beta-prop_EML_2 | 36 | 100 | 4.4e-13 | 49.9 |
| LXL04_013818 | PF25168.2 | Beta-prop_WDR36-Utp21_2nd | 36 | 82 | 1.2e-10 | 41.9 |
| LXL04_013818 | PF24817.2 | WD40_WDHD1_1st | 37 | 90 | 7.9e-16 | 58.8 |
| LXL04_013818 | PF25173.2 | Beta-prop_WDR3_1st | 38 | 105 | 4.2e-20 | 72.9 |
| LXL04_013818 | PF24805.2 | EIF3I | 38 | 106 | 1.7e-16 | 61.0 |
| LXL04_013818 | PF24807.2 | WD40_CDC20-Fz | 38 | 104 | 5.1e-14 | 53.0 |
| LXL04_013818 | PF25175.2 | Beta-prop_WDR5 | 40 | 132 | 3.4e-29 | 102.8 |
| LXL04_013818 | PF00400.39 | WD40 | 42 | 70 | 3.7e-12 | 46.9 |
| LXL04_013818 | PF23410.5 | Beta-prop_VPS8 | 42 | 106 | 1.4e-08 | 34.9 |
| LXL04_013818 | PF23414.2 | Beta-prop_EML_2 | 185 | 306 | 4.4e-13 | 49.9 |
| LXL04_013818 | PF25175.2 | Beta-prop_WDR5 | 189 | 331 | 3.4e-29 | 102.8 |
| LXL04_013818 | PF24807.2 | WD40_CDC20-Fz | 193 | 343 | 5.1e-14 | 53.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9LYK6 | Arabidopsis thaliana | Protein ANTHESIS PROMOTING FACTOR 1 | 45.092% | Swiss-Prot | moderate database homology |