Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2289 bp · LXL04_013799|LXL04_013799|OH1004|cDNA
ATGACAGCAACGGCTTCTGTTTCTTCTCCATGGATTCCTGAAGATGACCTGTTGCTTAAGAATTCAATCGAGGGTGGAGCTTCACTGGAAGCACTTGCAAAAGGGGCAGTAAAATTTTCCCGCAGATTTACCTTCCGTGAAATTCGAGATCGATGGTATTCTCTTCTCTATGACCCCGATGTGTCAGCTCAAGCTTCTGCCCGCATGGCTGAGCTGGAACTCTCTGGTAATTCCAATCCACCATCAAAATTAAAACCAGA...
2289 bp · LXL04_013799|LXL04_013799|OH1004|CDS
ATGACAGCAACGGCTTCTGTTTCTTCTCCATGGATTCCTGAAGATGACCTGTTGCTTAAGAATTCAATCGAGGGTGGAGCTTCACTGGAAGCACTTGCAAAAGGGGCAGTAAAATTTTCCCGCAGATTTACCTTCCGTGAAATTCGAGATCGATGGTATTCTCTTCTCTATGACCCCGATGTGTCAGCTCAAGCTTCTGCCCGCATGGCTGAGCTGGAACTCTCTGGTAATTCCAATCCACCATCAAAATTAAAACCAGA...
Protein
Download Protein FASTA762 aa · LXL04_013799|LXL04_013799|OH1004|PROTEIN
MTATASVSSPWIPEDDLLLKNSIEGGASLEALAKGAVKFSRRFTFREIRDRWYSLLYDPDVSAQASARMAELELSGNSNPPSKLKPDTTKPTDKVPEKRKSGSIRKHYHSWRKRIKNDYFSSQNLPFYEDRKTNHDAPGGSDGMLDLGFEEKDFEILRQAFPESIGSIAIATTTTTTTTTVIDNNQTNTFHMERCNHKYNHNHNHNQKSVENDYMNGSMREEEEEEEEGDLFNVSSPSRNMDPNIEMKNATCTSETPPNL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_013799 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_013799 |
|---|---|
| Location | Chr03:36124572-36127877 (+) |
| Description | Similar to MCRS1: Microspherule protein 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000723 telomere maintenance Biological Process GO:0006275 regulation of DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006282 regulation of DNA repair Biological Process GO:0006310 DNA recombination Biological Process GO:0006338 chromatin remodeling Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0033044 regulation of chromosome organization Biological Process GO:0036211 protein modification process Biological Process GO:0045739 positive regulation of DNA repair Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process |
| KEGG gene cross-reference | hsa:10445 mmu:51812 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13325.13MCRS_N11-73 aaPF00498.32FHA670-742 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_013799 | PF13325.13 | MCRS_N | 11 | 73 | 2.7e-19 | 70.6 |
| LXL04_013799 | PF00498.32 | FHA | 670 | 742 | 7.7e-08 | 33.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.