LXL04_013767 | RubberDandelionOmics

Gene overview

LXL04_013767

Reference: OH-1004 Chr: Chr03 Coordinates: 35669155-35672266 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1953 bp · LXL04_013767|LXL04_013767|OH1004|cDNA

aTGTCACAGCGGAAGCCTACTCGCATTTTTCAACGAGCACCCCGAGTTCGAGCTCCGCAAAGCGGGCAAACTCAGCCCCCAAGGGGATTTTCAGGGAAAATTTCACCGCACACAAGGCTTAATGCGAAGGATTTACCCGAGCATAGTACTACTCGATACCTCCACACCCCGTATGGGTTATTATATCCGATACATCACGTATGCCAGGATTCGAACACTGGACCTCCCACAGGGAGACCAGATGAACTAACCAACTGGGC...

CDS

Download CDS FASTA

1953 bp · LXL04_013767|LXL04_013767|OH1004|CDS

ATGTCACAGCGGAAGCCTACTCGCATTTTTCAACGAGCACCCCGAGTTCGAGCTCCGCAAAGCGGGCAAACTCAGCCCCCAAGGGGATTTTCAGGGAAAATTTCACCGCACACAAGGCTTAATGCGAAGGATTTACCCGAGCATAGTACTACTCGATACCTCCACACCCCGTATGGGTTATTATATCCGATACATCACGTATGCCAGGATTCGAACACTGGACCTCCCACAGGGAGACCAGATGAACTAACCAACTGGGC...

Protein

Download Protein FASTA

650 aa · LXL04_013767|LXL04_013767|OH1004|PROTEIN

MSQRKPTRIFQRAPRVRAPQSGQTQPPRGFSGKISPHTRLNAKDLPEHSTTRYLHTPYGLLYPIHHVCQDSNTGPPTGRPDELTNWASDHLYLYRKLAASNNSPFIYVVVSLLNSPATLHLPQSTQKLFISKMSSKTKSKIPTVSTIVSTIGSVAAAAVVARSVARDYLPPEVRNYLYLGLRNIINKFSTHLTMVIYESEGFQDNELYEATELYLAAKMSTQIHLLKVTKTPNQSNITVAMEVNEEFTDVFNGVKLYWSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013767`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013767

Location Chr03:35669155-35672266 (+)

Description Similar to HSR4: Protein HYPER-SENSITIVITY-RELATED 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50930`	Protein HYPER-SENSITIVITY-RELATED 4.	No verified direct reference in this release
`At3g50940`	AAA-ATPase At3g50940.	No verified direct reference in this release
`At2g18190`	AAA-ATPase At2g18190.	No verified direct reference in this release
`At2g18193`	AAA-ATPase At2g18193.	No verified direct reference in this release
`At5g17740`	AAA-ATPase At5g17740.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013767 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006950 response to stress Biological Process

GO:0009411 response to UV Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009863 salicylic acid mediated signaling pathway Biological Process

GO:0012501 programmed cell death Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT2G18190

ath:AT2G18193

ath:AT3G50930

ath:AT3G50940

ath:AT5G17740

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.275

Rank 1 · LXL04_013767 · OH-1004

Plastid0.215

Rank 2 · LXL04_013767 · OH-1004

Nucleus0.201

Rank 3 · LXL04_013767 · OH-1004

Mitochondrion0.164

Rank 4 · LXL04_013767 · OH-1004

Endoplasmic reticulum0.116

Rank 5 · LXL04_013767 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14363.12AAA_assoc169-261 aa

PF00004.36AAA387-526 aa

PF25568.1AAA_lid_At3g28540528-598 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013767	`PF14363.12`	AAA_assoc	169	261	2.9e-23	82.8
LXL04_013767	`PF00004.36`	AAA	387	526	2.8e-19	70.6
LXL04_013767	`PF25568.1`	AAA_lid_At3g28540	528	598	7.7e-21	74.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZG2`	Arabidopsis thaliana	Protein HYPER-SENSITIVITY-RELATED 4	54.125%	Swiss-Prot	strong database homology
`Q147F9`	Arabidopsis thaliana	AAA-ATPase At3g50940	53.813%	Swiss-Prot	strong database homology
`F4IQG2`	Arabidopsis thaliana	AAA-ATPase At2g18190	45.666%	Swiss-Prot	moderate database homology
`Q8GW96`	Arabidopsis thaliana	AAA-ATPase At2g18193	46.429%	Swiss-Prot	moderate database homology
`Q9FN77`	Arabidopsis thaliana	AAA-ATPase At5g17740	42.767%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card