LXL04_013736 | RubberDandelionOmics

Gene overview

LXL04_013736

Reference: OH-1004 Chr: Chr03 Coordinates: 35095382-35099113 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1524 bp · LXL04_013736|LXL04_013736|OH1004|cDNA

ATGGGGGATTACAATGATGCGTTCATGCGCAACAACAACGCTGCCGTTCAGGCTCGAACGAAGCAACAGAACCGAGCTAATCTCATGCAGATGAAGCTGATTGGACAGAGTCATCCAACAGGATTAACTAATAATCTGTTGAAGCTTTTTGAGCCACGACCTCCTCTAGAGTATAAGCCACCTCCTGAGAAGAGAAAATGTCCGCCATACACAGGCATGGCGCAATTTGTTAGCAACTTTGCTGAGCCAACTGACCCTGA...

CDS

Download CDS FASTA

1524 bp · LXL04_013736|LXL04_013736|OH1004|CDS

ATGGGGGATTACAATGATGCGTTCATGCGCAACAACAACGCTGCCGTTCAGGCTCGAACGAAGCAACAGAACCGAGCTAATCTCATGCAGATGAAGCTGATTGGACAGAGTCATCCAACAGGATTAACTAATAATCTGTTGAAGCTTTTTGAGCCACGACCTCCTCTAGAGTATAAGCCACCTCCTGAGAAGAGAAAATGTCCGCCATACACAGGCATGGCGCAATTTGTTAGCAACTTTGCTGAGCCAACTGACCCTGA...

Protein

Download Protein FASTA

507 aa · LXL04_013736|LXL04_013736|OH1004|PROTEIN

MGDYNDAFMRNNNAAVQARTKQQNRANLMQMKLIGQSHPTGLTNNLLKLFEPRPPLEYKPPPEKRKCPPYTGMAQFVSNFAEPTDPEYAPPVVKGETPGQRRARIHQLRLEEGAKKAAEELEHYDPNSDPNISGDPYKTLFVARLNYETTESRIKREFEAYGPIKRVGFVEFPEKGLLFGKRFDFVVRLIAEKETNKPRGYAFIEYMHTRDMKAAYKQADGRKLDNRRVLVDVERGRTVPNWRPRRLGGGLGTTRVGGED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013736`
TK1151 ID	TkA02G474690
OH-1004 ID	LXL04_013736
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013736

Location Chr03:35095382-35099113 (+)

Description Similar to RNU1: U1 small nuclear ribonucleoprotein 70 kDa

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50670`	Mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013736 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000387 spliceosomal snRNP assembly Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0048026 positive regulation of mRNA splicing, via spliceosome Biological Process

GO:0061084 negative regulation of protein refolding Biological Process

GO:0071300 cellular response to retinoic acid Biological Process

GO:0071356 cellular response to tumor necrosis factor Biological Process

GO:0071560 cellular response to transforming growth factor beta stimulus Biological Process

GO:1904715 negative regulation of chaperone-mediated autophagy Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005681 spliceosomal complex Cellular Component

KEGG gene cross-reference

ath:AT3G50670

bta:535113

hsa:6625

mmu:20637

xtr:493488

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · LXL04_013736 · OH-1004

Cytoplasm0.130

Rank 2 · LXL04_013736 · OH-1004

Cell membrane0.016

Rank 3 · LXL04_013736 · OH-1004

Mitochondrion0.013

Rank 4 · LXL04_013736 · OH-1004

Endoplasmic reticulum0.007

Rank 5 · LXL04_013736 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12220.15U1snRNP70_N41-129 aa

PF00076.29RRM_1140-169 aa

PF00076.29RRM_1187-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013736	`PF12220.15`	U1snRNP70_N	41	129	8.7e-20	71.8
LXL04_013736	`PF00076.29`	RRM_1	140	169	1.2e-13	51.5
LXL04_013736	`PF00076.29`	RRM_1	187	229	1.2e-13	51.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42404`	Arabidopsis thaliana	U1 small nuclear ribonucleoprotein 70 kDa	67.568%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card