LXL04_013660 | RubberDandelionOmics

Gene overview

LXL04_013660

Reference: OH-1004 Chr: Chr03 Coordinates: 33759289-33765078 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1407 bp · LXL04_013660|LXL04_013660|OH1004|cDNA

ATGGCGAAAGGCTTGGTGTTGACGTTGAATAATCGTAAGAATTTGTCTGCTCCAACTATGCCGCCCGATTACTTTGCCCTAAATAAGTCAGCCGCTCCATCAATAAGATTACAACCTTCGCATAAAACCAGCTACCTCGAGTTCGATGCTCGTTTCCCGGTGGAGACATCGCTTCATCATCGTCGTTTGGGCACTGACTCAGGTGGAGCTTGGACTCGAAAGACTAACAGAGACTACTATTTTCTTGGGGAGCTTCCATA...

CDS

Download CDS FASTA

1407 bp · LXL04_013660|LXL04_013660|OH1004|CDS

ATGGCGAAAGGCTTGGTGTTGACGTTGAATAATCGTAAGAATTTGTCTGCTCCAACTATGCCGCCCGATTACTTTGCCCTAAATAAGTCAGCCGCTCCATCAATAAGATTACAACCTTCGCATAAAACCAGCTACCTCGAGTTCGATGCTCGTTTCCCGGTGGAGACATCGCTTCATCATCGTCGTTTGGGCACTGACTCAGGTGGAGCTTGGACTCGAAAGACTAACAGAGACTACTATTTTCTTGGGGAGCTTCCATA...

Protein

Download Protein FASTA

468 aa · LXL04_013660|LXL04_013660|OH1004|PROTEIN

MAKGLVLTLNNRKNLSAPTMPPDYFALNKSAAPSIRLQPSHKTSYLEFDARFPVETSLHHRRLGTDSGGAWTRKTNRDYYFLGELPYLNNAESVAYEGVTLIILVVHTLFPILYGGGRLYWKSHFNKLKLISSISLQLPYILFHLGFHLILGDLRNSLAVMPGMLYTYLNVLALWLLFLLFSSWLAYVIFEDTQQGTRVFMSYLSTLYHMFVLFTTSNNLDVWIPAYKSSRWYSIFFILYEHVLSERKRREKLAQRFMSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013660`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013660

Location Chr03:33759289-33765078 (+)

Description Similar to TPC1: Two pore calcium channel protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g03560`	May act as a voltage-gated inward-rectifying Ca²⁺ channel in the vacuolar membrane.	Aluminum as a specific inhibitor of plant TPC1 Ca2+ channels.2004 · DOI: 10.1016/j.bbrc.2004.09.015 The vacuolar Ca2+-activated channel TPC1 regulates germination and stomatal movement.2005 · DOI: 10.1038/nature03381

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0678500`	May act as a voltage-gated Ca²⁺ channel in calcium signaling and defense responses.	Functional analysis of a rice putative voltage-dependent Ca2+ channel, OsTPC1, expressed in yeast cells lacking its homologous gene CCH1.2004 · DOI: 10.1093/pcp/pch053 Identification of a putative voltage-gated Ca2+ -permeable channel (OsTPC1) involved in Ca2+ influx and regulation of growth and development in rice.2004 · DOI: 10.1093/pcp/pch082 Identification of a putative voltage-gated Ca2+ channel as a key regulator of elicitor-induced hypersensitive cell death and mitogen-activated protein kinase activation in rice.2005 · DOI: 10.1111/j.1365-313x.2005.02415.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013660 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006952 defense response Biological Process

GO:0009845 seed germination Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0080141 regulation of jasmonic acid biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT4G03560

dosa:Os01g0678500

nta:107770546

nta:107819477

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.402

Rank 1 · LXL04_013660 · OH-1004

Cytoplasm0.242

Rank 2 · LXL04_013660 · OH-1004

Cell membrane0.239

Rank 3 · LXL04_013660 · OH-1004

Endoplasmic reticulum0.210

Rank 4 · LXL04_013660 · OH-1004

Golgi apparatus0.072

Rank 5 · LXL04_013660 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010.32HLH242-287 aa

PF23177.2bHLH_IRO3245-297 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013660	`PF00010.32`	HLH	242	287	4.4e-11	43.1
LXL04_013660	`PF23177.2`	bHLH_IRO3	245	297	8.5e-09	36.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94KI8`	Arabidopsis thaliana	Two pore calcium channel protein 1	54.301%	Swiss-Prot	weak database homology
`Q5QM84`	Oryza sativa subsp. japonica	Two pore calcium channel protein 1	54.696%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card