LXL04_013589 | RubberDandelionOmics

Gene overview

LXL04_013589

Reference: OH-1004 Chr: Chr03 Coordinates: 32179964-32192690 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3477 bp · LXL04_013589|LXL04_013589|OH1004|cDNA

ATGACACAATTCCCCTGGCCATTGGTGCTCCTCTCAATTTTTATGCTGTTTTATAATATGTGGTCGTTGTTTGTTTCGGCGGCCGTCGATAATTCAACCACTGTGATTCTCCGTTCTCCTCATTCTGGCAGCGATCGTCACACCATGTTTCTACCTCTTTTTCATTCTCCTTCTTCCCCCTCCTTCGGCGACGAAAAATCTCGGCGCCGCCTCCACACATCCGATGCTCCTAGCCCGAACGCTCGGATGGCTCTCCATGA...

CDS

Download CDS FASTA

3477 bp · LXL04_013589|LXL04_013589|OH1004|CDS

ATGACACAATTCCCCTGGCCATTGGTGCTCCTCTCAATTTTTATGCTGTTTTATAATATGTGGTCGTTGTTTGTTTCGGCGGCCGTCGATAATTCAACCACTGTGATTCTCCGTTCTCCTCATTCTGGCAGCGATCGTCACACCATGTTTCTACCTCTTTTTCATTCTCCTTCTTCCCCCTCCTTCGGCGACGAAAAATCTCGGCGCCGCCTCCACACATCCGATGCTCCTAGCCCGAACGCTCGGATGGCTCTCCATGA...

Protein

Download Protein FASTA

1158 aa · LXL04_013589|LXL04_013589|OH1004|PROTEIN

MTQFPWPLVLLSIFMLFYNMWSLFVSAAVDNSTTVILRSPHSGSDRHTMFLPLFHSPSSPSFGDEKSRRRLHTSDAPSPNARMALHDDLLFDGYFTTSLWIGAPPQKFALIVDTGSTVTYVPCSTCQRCGNHQDPKFNPHLSSTYQPLRCNPGCTCANDTQQCTYERKYAELSTSSGVLGEDFISFGNLGDVLPQRAIFGCENMETGDLYSQHADGIMGLGRGDPSIVDQLVDKGVIRDSFSLCYGGMDTGGGAMVLGGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013589`
TK1151 ID	TkA02G486720
OH-1004 ID	LXL04_013589
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	78.000
Protein coverage (%)	TK1151 98.655 / OH-1004 46.287 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013589

Location Chr03:32179964-32192690 (+)

Description Similar to At1g65240: Aspartic proteinase-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g36260`	Displays aspartic proteolytic activity.	No verified direct reference in this release
`At1g65240`	Displays aspartic proteolytic activity.	No verified direct reference in this release
`At3g18490`	Aspartic protease involved in drought avoidance through abscisic acid signaling.	Overexpression of the aspartic protease ASPG1 gene confers drought avoidance in Arabidopsis.2012 · DOI: 10.1093/jxb/err433

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013589 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009555 pollen development Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0090406 pollen tube Cellular Component

KEGG gene cross-reference

ath:AT1G65240

ath:AT5G36260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.278

Rank 1 · LXL04_013589 · OH-1004

Lysosome / Vacuole0.246

Rank 2 · LXL04_013589 · OH-1004

Extracellular0.215

Rank 3 · LXL04_013589 · OH-1004

Endoplasmic reticulum0.155

Rank 4 · LXL04_013589 · OH-1004

Cytoplasm0.149

Rank 5 · LXL04_013589 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543.12TAXi_N95-259 aa

PF00026.29Asp96-427 aa

PF14541.12TAXi_C279-427 aa

PF14543.12TAXi_N664-828 aa

PF00026.29Asp664-901 aa

PF14541.12TAXi_C848-950 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013589	`PF14543.12`	TAXi_N	95	259	6.7e-69	232.3
LXL04_013589	`PF00026.29`	Asp	96	427	4.2e-61	207.8
LXL04_013589	`PF14541.12`	TAXi_C	279	427	1.9e-46	158.5
LXL04_013589	`PF14543.12`	TAXi_N	664	828	6.7e-69	232.3
LXL04_013589	`PF00026.29`	Asp	664	901	4.2e-61	207.8
LXL04_013589	`PF14541.12`	TAXi_C	848	950	1.9e-46	158.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4V3D2`	Arabidopsis thaliana	Aspartic proteinase 36	32.166%	Swiss-Prot	weak database homology
`Q9S9K4`	Arabidopsis thaliana	Aspartic proteinase 39	30.446%	Swiss-Prot	weak database homology
`Q9LS40`	Arabidopsis thaliana	Protein ASPARTIC PROTEASE IN GUARD CELL 1	29.058%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card