LXL04_013578 | RubberDandelionOmics

Gene overview

LXL04_013578

Reference: OH-1004 Chr: Chr03 Coordinates: 32022961-32024391 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1431 bp · LXL04_013578|LXL04_013578|OH1004|cDNA

ATGTTCACCTGCAAGAAATCCAAAACCCTCCAATTCATAACTAATACTTCTCACTCGATTCACTCTCAAATTACTTCACACCCACGAATTTCCCTTTTCATCTTCTCGCTTTTCCTCGTACAAATCATCATACTCTGTTCTCCCTCcccgccgccgccgccggtaTCTCTCCCACCTCCGGTTGATGATAAATGCAAGGAAGGTCAGGTTTACGTGTACGAACTCCCAACCATGTTCAATTCCGATTTAGTGGGTACCTG...

CDS

Download CDS FASTA

1431 bp · LXL04_013578|LXL04_013578|OH1004|CDS

ATGTTCACCTGCAAGAAATCCAAAACCCTCCAATTCATAACTAATACTTCTCACTCGATTCACTCTCAAATTACTTCACACCCACGAATTTCCCTTTTCATCTTCTCGCTTTTCCTCGTACAAATCATCATACTCTGTTCTCCCTCCCCGCCGCCGCCGCCGGTATCTCTCCCACCTCCGGTTGATGATAAATGCAAGGAAGGTCAGGTTTACGTGTACGAACTCCCAACCATGTTCAATTCCGATTTAGTGGGTACCTG...

Protein

Download Protein FASTA

476 aa · LXL04_013578|LXL04_013578|OH1004|PROTEIN

MFTCKKSKTLQFITNTSHSIHSQITSHPRISLFIFSLFLVQIIILCSPSPPPPPVSLPPPVDDKCKEGQVYVYELPTMFNSDLVGTCEDLDPWHWQCGVATNGGYGMTATELAGIIPESLVQVWHRTNQFSSEIIFHNRILKHKCRTMEPEAATAFYIPFYAGLAVGKYLFTDSTNEERDFHAVQLIKWVQNQSYWRRSNGSDHVLVLGRITWDFRRLTDPEKRWGSTFLNMPEMQTVTRLTIERAPGDYQDVGIPYPTG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013578`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013578

Location Chr03:32022961-32024391 (+)

Description Similar to XLT2: Xyloglucan galactosyltransferase XLT2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62220`	Functions in xyloglucan synthesis by adding side chains to the xylosylated glucan backbone.	RNA-Seq analysis of developing nasturtium seeds (Tropaeolum majus): identification and characterization of an additional galactosyltransferase involved in xyloglucan biosynthesis.2012 · DOI: 10.1093/mp/sss032 Protein-protein interactions among xyloglucan-synthesizing enzymes and formation of Golgi-localized multiprotein complexes.2015 · DOI: 10.1093/pcp/pcu161
`At2g20370`	Involved in the attachment of the Gal residue on the third xylosyl unit within the XXXG core structure of xyloglucan, the principal glycan that interlaces the cellulose microfibrils in plant cell wall.	The MUR3 gene of Arabidopsis encodes a xyloglucan galactosyltransferase that is evolutionarily related to animal exostosins.2003 · DOI: 10.1105/tpc.009837 KATAMARI1/MURUS3 Is a novel golgi membrane protein that is required for endomembrane organization in Arabidopsis.2005 · DOI: 10.1105/tpc.105.031930 A bi-functional xyloglucan galactosyltransferase is an indispensable salt stress tolerance determinant in Arabidopsis.2013 · DOI: 10.1093/mp/sst062 Protein-protein interactions among xyloglucan-synthesizing enzymes and formation of Golgi-localized multiprotein complexes.2015 · DOI: 10.1093/pcp/pcu161
`At1g63450`	Xyloglucan-specific galacturonosyltransferase that forms the beta-D-galactosyluronic acid-(1->2)-alpha-D-xylosyl linkage.	A galacturonic acid-containing xyloglucan is involved in Arabidopsis root hair tip growth.2012 · DOI: 10.1105/tpc.112.103390
`At2g29040`	Functions in xyloglucan synthesis by adding side chains to the xylosylated glucan backbone.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0144800`	Involved in the attachment of the Gal residue on the third xylosyl unit within the XXXG core structure of xyloglucan, the principal glycan that interlaces the cellulose microfibrils in plant cell wall.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013578 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000271 polysaccharide biosynthetic process Biological Process

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009863 salicylic acid mediated signaling pathway Biological Process

GO:0009969 xyloglucan biosynthetic process Biological Process

GO:0010256 endomembrane system organization Biological Process

GO:0042353 fucose biosynthetic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0048767 root hair elongation Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

KEGG gene cross-reference

ath:AT1G63450

ath:AT2G20370

ath:AT5G62220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.837

Rank 1 · LXL04_013578 · OH-1004

Endoplasmic reticulum0.082

Rank 2 · LXL04_013578 · OH-1004

Cell membrane0.047

Rank 3 · LXL04_013578 · OH-1004

Cytoplasm0.035

Rank 4 · LXL04_013578 · OH-1004

Extracellular0.034

Rank 5 · LXL04_013578 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03016.21Exostosin_GT4765-403 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013578	`PF03016.21`	Exostosin_GT47	65	403	2e-71	241.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K6F1`	Arabidopsis thaliana	Xyloglucan galactosyltransferase XLT2	56.250%	Swiss-Prot	strong database homology
`Q7XJ98`	Arabidopsis thaliana	Xyloglucan galactosyltransferase MUR3	39.329%	Swiss-Prot	moderate database homology
`Q9SH31`	Arabidopsis thaliana	Xyloglucan-specific galacturonosyltransferase 1	40.050%	Swiss-Prot	moderate database homology
`O81072`	Arabidopsis thaliana	Probable xyloglucan galactosyltransferase GT11	39.066%	Swiss-Prot	moderate database homology
`Q8H038`	Oryza sativa subsp. japonica	Xyloglucan galactosyltransferase KATAMARI1 homolog	40.806%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card