LXL04_013555 | RubberDandelionOmics

Gene overview

LXL04_013555

Reference: OH-1004 Chr: Chr03 Coordinates: 31407678-31409612 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

534 bp · LXL04_013555|LXL04_013555|OH1004|cDNA

ATGAGTTGGGCGAGACTGTGTTCATTATTGGGTGAATTGGGGTACGAAGGTCACGGGGCACTTGATCCAGACAACTTTCATTGGCCATTTCAGTACGAAGATGCTCGTCCGATACTCGATTGGCTATGCTCCAGCCTTTGTCCCTCCAACGTCCTCTTCGCCTCTGAACTTTTCCAGGTTCTACTTCAGCCTTTAAAACAGATGCCATGGAGCTACAGAGACAACTTGGTCATCTACATTCTACAGTCTAAATATGACAT...

CDS

Download CDS FASTA

534 bp · LXL04_013555|LXL04_013555|OH1004|CDS

ATGAGTTGGGCGAGACTGTGTTCATTATTGGGTGAATTGGGGTACGAAGGTCACGGGGCACTTGATCCAGACAACTTTCATTGGCCATTTCAGTACGAAGATGCTCGTCCGATACTCGATTGGCTATGCTCCAGCCTTTGTCCCTCCAACGTCCTCTTCGCCTCTGAACTTTTCCAGGTTCTACTTCAGCCTTTAAAACAGATGCCATGGAGCTACAGAGACAACTTGGTCATCTACATTCTACAGTCTAAATATGACAT...

Protein

Download Protein FASTA

177 aa · LXL04_013555|LXL04_013555|OH1004|PROTEIN

MSWARLCSLLGELGYEGHGALDPDNFHWPFQYEDARPILDWLCSSLCPSNVLFASELFQVLLQPLKQMPWSYRDNLVIYILQSKYDMLSTQASALIQGKRARVTSTSIVNGQLTTIDDSLSARNLEMNAVLGKIASTTQELAHFHSGNDLERVKDSGLKPKLRMQISKLFYWHLKVK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013555`
TK1151 ID	TkA07G423760
OH-1004 ID	LXL04_013555
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	69.700
Protein coverage (%)	TK1151 83.544 / OH-1004 66.102 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013555

Location Chr03:31407678-31409612 (+)

Description Similar to AUG3: AUGMIN subunit 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48520`	Involved in microtubules reorganization during spindle and phragmoplast development.	Augmin plays a critical role in organizing the spindle and phragmoplast microtubule arrays in Arabidopsis.2011 · DOI: 10.1105/tpc.111.086892

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013555 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0031023 microtubule organizing center organization Biological Process

GO:0051225 spindle assembly Biological Process

GO:0051301 cell division Biological Process

GO:0080175 phragmoplast microtubule organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005815 microtubule organizing center Cellular Component

GO:0005819 spindle Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0070652 HAUS complex Cellular Component

GO:0072686 mitotic spindle Cellular Component

KEGG gene cross-reference

ath:AT5G48520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.449

Rank 1 · LXL04_013555 · OH-1004

Nucleus0.426

Rank 2 · LXL04_013555 · OH-1004

Mitochondrion0.102

Rank 3 · LXL04_013555 · OH-1004

Endoplasmic reticulum0.075

Rank 4 · LXL04_013555 · OH-1004

Cell membrane0.075

Rank 5 · LXL04_013555 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14932.12HAUS-augmin328-57 aa

PF14932.12HAUS-augmin381-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013555	`PF14932.12`	HAUS-augmin3	28	57	1.1e-21	78.2
LXL04_013555	`PF14932.12`	HAUS-augmin3	81	159	1.1e-21	78.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WQE7`	Arabidopsis thaliana	AUGMIN subunit 3	51.031%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card